Citrus Sinensis ID: 034131


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MVYVTSWDEFVGRSVQLYKADPQSTRYCMKYRHCDGKLVLKVTDNKECLKFKTDQAQDAKKMEKLNNIFFALMARGPDVDLSEVTGKEQMEAQPAKKGRGRKQ
ccccccHHHHHHHHHHHHHHcccccEEEEEEECcccEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
MVYVTSWDEFVGRSVQLYKADPQSTRYCMKYRHCDGKLVLKVTDNKECLKFKTDQAQDAKKMEKLNNIFFALMAR****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYVTSWDEFVGRSVQLYKADPQSTRYCMKYRHCDGKLVLKVTDNKECLKFKTDQAQDAKKMEKLNNIFFALMARGPDVDLSEVTGKEQMEAQPAKKGRGRKQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 9 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.confidentQ9SMU7
Signal recognition particle 9 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.probableO04438
Signal recognition particle 9 kDa protein Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.probableP49458

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1914, chain A
Confidence level:very confident
Coverage over the Query: 4-80
View the alignment between query and template
View the model in PyMOL