Citrus Sinensis ID: 034158

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--

MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIAARSSKKPSSKL

cccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccc

cccccccHHHHHHHccEcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccc

maatpitaeqgerwglVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIAArsskkpsskl

maatpitaeqgerwglvNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIaarsskkpsskl

MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIAARSSKKPSSKL

***********ERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGM************************

MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIAARS********

MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEF*************

*AATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIAA**********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTKEQFKKMQEFIAARSSKKPSSKL

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		102	2.2.26 [Sep-21-2011]
P52046		261	3-hydroxybutyryl-CoA dehy	yes	no	0.892	0.348	0.354	2e-06
O34893		260	Putative enoyl-CoA hydrat	yes	no	0.803	0.315	0.333	0.0004

>sp\|P52046\|CRT_CLOAB 3-hydroxybutyryl-CoA dehydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=3 SV=1	Back alignment and function desciption

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 1   MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDL 60
             A  I A++  R GLVN VVE  EL+  A  +A  ++ N    V   K  IN G++ D+
Sbjct: 163 FTAQNIKADEALRIGLVNKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDI 222

Query: 61  GHALALEKERAHDYYNGMTKEQFKKMQEFIAAR 93
             ALA E E   + ++  T++Q   M  FI  R
Sbjct: 223 DTALAFESEAFGECFS--TEDQKDAMTAFIEKR 253

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (taxid: 272562)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 5

>sp\|O34893\|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		102
147827140		260	hypothetical protein VITISV_034763 [Viti	1.0	0.392	0.843	2e-44
225431978		266	PREDICTED: 3-hydroxypropionyl-coenzyme A	1.0	0.383	0.843	2e-44
255556404		265	3-hydroxybutyryl-CoA dehydratase, putati	1.0	0.384	0.803	8e-43
224101549		265	predicted protein [Populus trichocarpa]	1.0	0.384	0.794	4e-42
118489327		264	unknown [Populus trichocarpa x Populus d	0.970	0.375	0.808	6e-42
224108744		264	predicted protein [Populus trichocarpa]	0.970	0.375	0.797	2e-41
351724255		278	peroxisomal enoyl-CoA hydratase/isomeras	0.970	0.356	0.808	4e-41
356564640		295	PREDICTED: 3-hydroxybutyryl-CoA dehydrat	0.970	0.335	0.797	1e-40
255642167		264	unknown [Glycine max]	0.970	0.375	0.787	4e-39
6469117		264	putative enoyl CoA hydratase [Cicer arie	0.970	0.375	0.747	6e-39

>gi\|147827140\|emb\|CAN70976.1\| hypothetical protein VITISV_034763 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 86/102 (84%), Positives = 92/102 (90%)

Query: 1   MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDL 60
           + A P+TAEQ ERWG VNHVVE  ELLKKA  VAEA+IKNNQDLV+RYK+VINDGLKLDL
Sbjct: 159 LTAMPVTAEQAERWGFVNHVVEGSELLKKAREVAEAIIKNNQDLVMRYKSVINDGLKLDL 218

Query: 61  GHALALEKERAHDYYNGMTKEQFKKMQEFIAARSSKKPSSKL 102
           GHALALEKERAH+YYNGMTKEQFKKMQEFIA RSSKKPS KL
Sbjct: 219 GHALALEKERAHNYYNGMTKEQFKKMQEFIAGRSSKKPSPKL 260

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225431978\|ref\|XP_002278726.1\| PREDICTED: 3-hydroxypropionyl-coenzyme A dehydratase [Vitis vinifera] gi\|296083235\|emb\|CBI22871.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255556404\|ref\|XP_002519236.1\| 3-hydroxybutyryl-CoA dehydratase, putative [Ricinus communis] gi\|223541551\|gb\|EEF43100.1\| 3-hydroxybutyryl-CoA dehydratase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224101549\|ref\|XP_002312326.1\| predicted protein [Populus trichocarpa] gi\|222852146\|gb\|EEE89693.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118489327\|gb\|ABK96468.1\| unknown [Populus trichocarpa x Populus deltoides]	Back alignment and taxonomy information

>gi\|224108744\|ref\|XP_002314953.1\| predicted protein [Populus trichocarpa] gi\|222863993\|gb\|EEF01124.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|351724255\|ref\|NP_001238331.1\| peroxisomal enoyl-CoA hydratase/isomerase family protein [Glycine max] gi\|167963118\|dbj\|BAG09364.1\| peroxisomal enoyl-CoA hydratase/isomerase family protein [Glycine max]	Back alignment and taxonomy information

>gi\|356564640\|ref\|XP_003550559.1\| PREDICTED: 3-hydroxybutyryl-CoA dehydratase-like [Glycine max]	Back alignment and taxonomy information

>gi\|255642167\|gb\|ACU21348.1\| unknown [Glycine max]	Back alignment and taxonomy information

>gi\|6469117\|emb\|CAB61740.1\| putative enoyl CoA hydratase [Cicer arietinum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		102
TAIR\|locus:2130265		265	ECHIA "enoyl-CoA hydratase/iso	1.0	0.384	0.725	5.1e-35
TIGR_CMR\|CHY_1601		260	CHY_1601 "3-hydroxybutyryl-CoA	0.892	0.35	0.354	1.5e-06
TIGR_CMR\|GSU_1377		260	GSU_1377 "3-hydroxybutyryl-CoA	0.833	0.326	0.348	1.9e-05
TIGR_CMR\|BA_2551		262	BA_2551 "enoyl-CoA hydratase/i	0.833	0.324	0.318	5.5e-05
ASPGD\|ASPL0000000440		240	AN6235 [Emericella nidulans (t	0.421	0.179	0.465	9.8e-05
DICTYBASE\|DDB_G0285071		277	echs1 "enoyl-CoA hydratase" [D	0.852	0.314	0.303	0.00017
TIGR_CMR\|CHY_1293		257	CHY_1293 "3-hydroxybutyryl-CoA	0.607	0.241	0.387	0.00067
TIGR_CMR\|CHY_1739		257	CHY_1739 "putative 3-hydroxybu	0.676	0.268	0.318	0.00067
TIGR_CMR\|CHY_1736		266	CHY_1736 "enoyl-CoA hydratase/	0.598	0.229	0.327	0.00092

TAIR\|locus:2130265 ECHIA "enoyl-CoA hydratase/isomerase A" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 379 (138.5 bits), Expect = 5.1e-35, P = 5.1e-35
 Identities = 74/102 (72%), Positives = 85/102 (83%)

Query:     1 MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDL 60
             + + P+TA+   + G VNHVVEEGE LKKA  +AEA+IKN Q +VLR K+VINDGLKLDL
Sbjct:   164 LTSMPLTADVAGKLGFVNHVVEEGEALKKAREIAEAIIKNEQGMVLRIKSVINDGLKLDL 223

Query:    61 GHALALEKERAHDYYNGMTKEQFKKMQEFIAARSSKKPSSKL 102
             GHAL LEKERAH YY+GMTKEQF+KMQEFIA R SKKPSSKL
Sbjct:   224 GHALTLEKERAHAYYSGMTKEQFRKMQEFIAGRGSKKPSSKL 265

GO:0003824 "catalytic activity" evidence=IEA;ISS

GO:0005739 "mitochondrion" evidence=ISM

GO:0008152 "metabolic process" evidence=IEA;ISS

GO:0005777 "peroxisome" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

GO:0006635 "fatty acid beta-oxidation" evidence=RCA

TIGR_CMR\|CHY_1601 CHY_1601 "3-hydroxybutyryl-CoA dehydratase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1377 GSU_1377 "3-hydroxybutyryl-CoA dehydratase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_2551 BA_2551 "enoyl-CoA hydratase/isomerase family protein" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000000440 AN6235 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0285071 echs1 "enoyl-CoA hydratase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1293 CHY_1293 "3-hydroxybutyryl-CoA dehydratase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1739 CHY_1739 "putative 3-hydroxybutyryl-CoA dehydratase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1736 CHY_1736 "enoyl-CoA hydratase/isomerase family protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		102
PLN02888		265	PLN02888, PLN02888, enoyl-CoA hydratase	1e-61
PRK06190		258	PRK06190, PRK06190, enoyl-CoA hydratase; Provision	3e-16
PRK07657		260	PRK07657, PRK07657, enoyl-CoA hydratase; Provision	2e-09
PRK05809		260	PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata	1e-08
PRK06688		259	PRK06688, PRK06688, enoyl-CoA hydratase; Provision	2e-08
COG1024		257	COG1024, CaiD, Enoyl-CoA hydratase/carnithine race	6e-08
PRK09076		258	PRK09076, PRK09076, enoyl-CoA hydratase; Provision	4e-07
cd06558		195	cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme	2e-06
PRK11423		261	PRK11423, PRK11423, methylmalonyl-CoA decarboxylas	4e-06
pfam00378		245	pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami	7e-06
PRK05980		260	PRK05980, PRK05980, enoyl-CoA hydratase; Provision	1e-05
PRK08258		277	PRK08258, PRK08258, enoyl-CoA hydratase; Provision	2e-05
PRK07658		257	PRK07658, PRK07658, enoyl-CoA hydratase; Provision	2e-05
PRK07509		262	PRK07509, PRK07509, enoyl-CoA hydratase; Provision	3e-05
PRK08138		261	PRK08138, PRK08138, enoyl-CoA hydratase; Provision	6e-05
PRK07511		260	PRK07511, PRK07511, enoyl-CoA hydratase; Provision	1e-04
PLN02600		251	PLN02600, PLN02600, enoyl-CoA hydratase	2e-04
PRK07327		268	PRK07327, PRK07327, enoyl-CoA hydratase; Provision	2e-04
PRK09245		266	PRK09245, PRK09245, enoyl-CoA hydratase; Provision	3e-04
PRK08140		262	PRK08140, PRK08140, enoyl-CoA hydratase; Provision	4e-04
PRK06494		259	PRK06494, PRK06494, enoyl-CoA hydratase; Provision	6e-04
PRK05862		257	PRK05862, PRK05862, enoyl-CoA hydratase; Provision	9e-04
PRK07799		263	PRK07799, PRK07799, enoyl-CoA hydratase; Provision	0.001
PRK08252		254	PRK08252, PRK08252, enoyl-CoA hydratase; Provision	0.001
TIGR02280		256	TIGR02280, PaaB1, phenylacetate degradation probab	0.002
PRK05981		266	PRK05981, PRK05981, enoyl-CoA hydratase; Provision	0.004
PRK08290		288	PRK08290, PRK08290, enoyl-CoA hydratase; Provision	0.004

>gnl\|CDD\|215480 PLN02888, PLN02888, enoyl-CoA hydratase	Back alignment and domain information

 Score =  188 bits (479), Expect = 1e-61
 Identities = 83/99 (83%), Positives = 89/99 (89%)

Query: 1   MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDL 60
           + A P+TAE  ERWGLVNHVVEE ELLKKA  VAEA+IKNNQ +VLRYK+VINDGLKLDL
Sbjct: 165 LTAMPLTAETAERWGLVNHVVEESELLKKAREVAEAIIKNNQGMVLRYKSVINDGLKLDL 224

Query: 61  GHALALEKERAHDYYNGMTKEQFKKMQEFIAARSSKKPS 99
           GHAL LEKERAHDYYNGMTKEQF+KMQEFIA RSSKKPS
Sbjct: 225 GHALQLEKERAHDYYNGMTKEQFQKMQEFIAGRSSKKPS 263

Length = 265

>gnl\|CDD\|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated	Back alignment and domain information

>gnl\|CDD\|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|236373 PRK09076, PRK09076, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily	Back alignment and domain information

>gnl\|CDD\|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional	Back alignment and domain information

>gnl\|CDD\|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family	Back alignment and domain information

>gnl\|CDD\|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|178210 PLN02600, PLN02600, enoyl-CoA hydratase	Back alignment and domain information

>gnl\|CDD\|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB	Back alignment and domain information

>gnl\|CDD\|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional	Back alignment and domain information

>gnl\|CDD\|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		102
PLN02600		251	enoyl-CoA hydratase	99.85
TIGR02280		256	PaaB1 phenylacetate degradation probable enoyl-CoA	99.85
PRK08139		266	enoyl-CoA hydratase; Validated	99.85
PRK05862		257	enoyl-CoA hydratase; Provisional	99.84
PRK08258		277	enoyl-CoA hydratase; Provisional	99.84
PRK08140		262	enoyl-CoA hydratase; Provisional	99.84
PRK06495		257	enoyl-CoA hydratase; Provisional	99.84
PRK08252		254	enoyl-CoA hydratase; Provisional	99.84
PRK07658		257	enoyl-CoA hydratase; Provisional	99.84
PRK12478		298	enoyl-CoA hydratase; Provisional	99.84
PRK06127		269	enoyl-CoA hydratase; Provisional	99.84
PRK09076		258	enoyl-CoA hydratase; Provisional	99.84
PRK07799		263	enoyl-CoA hydratase; Provisional	99.84
PRK08150		255	enoyl-CoA hydratase; Provisional	99.84
PRK08138		261	enoyl-CoA hydratase; Provisional	99.84
PRK06563		255	enoyl-CoA hydratase; Provisional	99.84
PRK09674		255	enoyl-CoA hydratase-isomerase; Provisional	99.84
PRK05980		260	enoyl-CoA hydratase; Provisional	99.83
PRK06142		272	enoyl-CoA hydratase; Provisional	99.83
PRK05995		262	enoyl-CoA hydratase; Provisional	99.83
PRK09245		266	enoyl-CoA hydratase; Provisional	99.83
PRK05981		266	enoyl-CoA hydratase; Provisional	99.83
PRK07657		260	enoyl-CoA hydratase; Provisional	99.83
PRK05809		260	3-hydroxybutyryl-CoA dehydratase; Validated	99.83
PRK06494		259	enoyl-CoA hydratase; Provisional	99.83
PRK07468		262	enoyl-CoA hydratase; Provisional	99.83
PLN02664		275	enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA	99.82
PRK03580		261	carnitinyl-CoA dehydratase; Provisional	99.82
PRK07511		260	enoyl-CoA hydratase; Provisional	99.82
PRK06210		272	enoyl-CoA hydratase; Provisional	99.82
PRK06688		259	enoyl-CoA hydratase; Provisional	99.82
PRK07659		260	enoyl-CoA hydratase; Provisional	99.82
PRK05674		265	gamma-carboxygeranoyl-CoA hydratase; Validated	99.82
PLN02888		265	enoyl-CoA hydratase	99.81
PRK07938		249	enoyl-CoA hydratase; Provisional	99.81
KOG1680		290	consensus Enoyl-CoA hydratase [Lipid transport and	99.81
PRK05864		276	enoyl-CoA hydratase; Provisional	99.81
TIGR01929		259	menB naphthoate synthase (dihydroxynaphthoic acid	99.8
PRK07396		273	dihydroxynaphthoic acid synthetase; Validated	99.8
PRK11423		261	methylmalonyl-CoA decarboxylase; Provisional	99.8
PRK08184		550	benzoyl-CoA-dihydrodiol lyase; Provisional	99.79
PRK06143		256	enoyl-CoA hydratase; Provisional	99.79
PLN02921		327	naphthoate synthase	99.79
PRK06144		262	enoyl-CoA hydratase; Provisional	99.78
PLN03214		278	probable enoyl-CoA hydratase/isomerase; Provisiona	99.78
PRK08259		254	enoyl-CoA hydratase; Provisional	99.78
TIGR03210		256	badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb	99.77
TIGR03222		546	benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p	99.77
PRK08321		302	naphthoate synthase; Validated	99.77
PRK07260		255	enoyl-CoA hydratase; Provisional	99.77
PRK05617		342	3-hydroxyisobutyryl-CoA hydrolase; Provisional	99.76
PRK08260		296	enoyl-CoA hydratase; Provisional	99.76
PRK07509		262	enoyl-CoA hydratase; Provisional	99.76
PRK06072		248	enoyl-CoA hydratase; Provisional	99.76
PRK07327		268	enoyl-CoA hydratase; Provisional	99.75
TIGR03189		251	dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy	99.75
PRK07827		260	enoyl-CoA hydratase; Provisional	99.75
PRK09120		275	p-hydroxycinnamoyl CoA hydratase/lyase; Validated	99.74
PRK07112		255	polyketide biosynthesis enoyl-CoA hydratase; Valid	99.74
PF00378		245	ECH: Enoyl-CoA hydratase/isomerase family; InterPr	99.74
PRK06023		251	enoyl-CoA hydratase; Provisional	99.72
PLN02874		379	3-hydroxyisobutyryl-CoA hydrolase-like protein	99.72
PRK07854		243	enoyl-CoA hydratase; Provisional	99.72
PRK05870		249	enoyl-CoA hydratase; Provisional	99.7
PRK07110		249	polyketide biosynthesis enoyl-CoA hydratase; Valid	99.66
COG1024		257	CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi	99.63
PRK06190		258	enoyl-CoA hydratase; Provisional	99.6
KOG1682		287	consensus Enoyl-CoA isomerase [Lipid transport and	99.6
COG0447		282	MenB Dihydroxynaphthoic acid synthase [Coenzyme me	99.55
PRK11154		708	fadJ multifunctional fatty acid oxidation complex	99.52
PRK11730		715	fadB multifunctional fatty acid oxidation complex	99.5
KOG0016		266	consensus Enoyl-CoA hydratase/isomerase [Lipid tra	99.48
TIGR02440		699	FadJ fatty oxidation complex, alpha subunit FadJ.	99.48
PRK08290		288	enoyl-CoA hydratase; Provisional	99.45
PRK06213		229	enoyl-CoA hydratase; Provisional	99.43
PLN02157		401	3-hydroxyisobutyryl-CoA hydrolase-like protein	99.42
PRK08272		302	enoyl-CoA hydratase; Provisional	99.41
PRK08788		287	enoyl-CoA hydratase; Validated	99.36
KOG1679		291	consensus Enoyl-CoA hydratase [Lipid transport and	99.35
PLN02988		381	3-hydroxyisobutyryl-CoA hydrolase	99.35
PRK05869		222	enoyl-CoA hydratase; Validated	99.29
PLN02851		407	3-hydroxyisobutyryl-CoA hydrolase-like protein	99.24
KOG1681		292	consensus Enoyl-CoA isomerase [Lipid transport and	99.24
TIGR02437		714	FadB fatty oxidation complex, alpha subunit FadB.	99.12
TIGR02441		737	fa_ox_alpha_mit fatty acid oxidation complex, alph	99.03
PLN02267		239	enoyl-CoA hydratase/isomerase family protein	98.91
PF13766		118	ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PD	98.87
KOG1684		401	consensus Enoyl-CoA hydratase [Lipid transport and	98.83
TIGR03200		360	dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy	98.59
TIGR03222		546	benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p	98.51
PRK08184		550	benzoyl-CoA-dihydrodiol lyase; Provisional	98.46
PLN02157		401	3-hydroxyisobutyryl-CoA hydrolase-like protein	98.28
cd06558		195	crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy	98.04
cd07020		187	Clp_protease_NfeD_1 Nodulation formation efficienc	97.44
TIGR00705		584	SppA_67K signal peptide peptidase SppA, 67K type.	95.59
PF01343		154	Peptidase_S49: Peptidase family S49 peptidase clas	95.59
TIGR00706		207	SppA_dom signal peptide peptidase SppA, 36K type.	95.11
PRK11778		330	putative inner membrane peptidase; Provisional	93.52
smart00250		38	PLEC Plectin repeat.	93.34
PF00681		45	Plectin: Plectin repeat; InterPro: IPR001101 Plect	92.63
PRK10949		618	protease 4; Provisional	92.6
KOG0840		275	consensus ATP-dependent Clp protease, proteolytic	90.77
PRK12319		256	acetyl-CoA carboxylase subunit alpha; Provisional	88.59
CHL00198		322	accA acetyl-CoA carboxylase carboxyltransferase al	87.1
PLN03230		431	acetyl-coenzyme A carboxylase carboxyl transferase	86.62
TIGR00513		316	accA acetyl-CoA carboxylase, carboxyl transferase,	85.7
PRK05724		319	acetyl-CoA carboxylase carboxyltransferase subunit	83.27
COG0616		317	SppA Periplasmic serine proteases (ClpP class) [Po	82.12
TIGR03200		360	dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy	81.75
PRK05654		292	acetyl-CoA carboxylase subunit beta; Validated	81.39
TIGR00515		285	accD acetyl-CoA carboxylase, carboxyl transferase,	80.72

>PLN02600 enoyl-CoA hydratase	Back alignment and domain information

Probab=99.85  E-value=1.3e-20  Score=123.58  Aligned_cols=97  Identities=25%  Similarity=0.359  Sum_probs=92.1

Q ss_pred             CCCcccCHHHHHhccccceecCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhcCCHHHHHHHHHHHHhHHhhcCCh
Q 034158            1 MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTK   80 (102)
Q Consensus         1 ltg~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~~~~l~~~~~~a~~~~K~~i~~~~~~~~~~~~~~e~~~~~~~~~~~~~   80 (102)
                      +||++++|+||+++||||+|||++++++.+.+++++|+..||.++..+|+.++.....++.+.+..|...+..++.  ++
T Consensus       154 ltg~~~~a~eA~~~Glv~~vv~~~~~~~~a~~~a~~la~~~p~a~~~~K~~l~~~~~~~~~~~~~~e~~~~~~~~~--~~  231 (251)
T PLN02600        154 FTGRRIGAREAASMGLVNYCVPAGEAYEKALELAQEINQKGPLAIKMAKKAINEGSEVDMASGLEIEEECYEQVLK--TK  231 (251)
T ss_pred             HhCCccCHHHHHHcCCCcEeeChhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHhC--CH
Confidence            5899999999999999999999999999999999999999999999999999988878899999999999988884  99


Q ss_pred             hHHHHHHHHHhhcCCCCCC
Q 034158           81 EQFKKMQEFIAARSSKKPS   99 (102)
Q Consensus        81 ~~~~~i~~fl~k~~~~~~~   99 (102)
                      ++++++.+|++|++|.|.+
T Consensus       232 d~~eg~~af~ekr~p~~~~  250 (251)
T PLN02600        232 DRLEGLAAFAEKRKPVYTG  250 (251)
T ss_pred             HHHHHHHHHhcCCCCCCCC
Confidence            9999999999999999975

>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB	Back alignment and domain information

>PRK08139 enoyl-CoA hydratase; Validated	Back alignment and domain information

>PRK05862 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK08258 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK08140 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06495 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK08252 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07658 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK12478 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06127 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK09076 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07799 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK08150 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK08138 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06563 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK09674 enoyl-CoA hydratase-isomerase; Provisional	Back alignment and domain information

>PRK05980 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06142 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK05995 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK09245 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK05981 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07657 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated	Back alignment and domain information

>PRK06494 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07468 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase	Back alignment and domain information

>PRK03580 carnitinyl-CoA dehydratase; Provisional	Back alignment and domain information

>PRK07511 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06210 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06688 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07659 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated	Back alignment and domain information

>PLN02888 enoyl-CoA hydratase	Back alignment and domain information

>PRK07938 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism]	Back alignment and domain information

>PRK05864 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase)	Back alignment and domain information

>PRK07396 dihydroxynaphthoic acid synthetase; Validated	Back alignment and domain information

>PRK11423 methylmalonyl-CoA decarboxylase; Provisional	Back alignment and domain information

>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional	Back alignment and domain information

>PRK06143 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PLN02921 naphthoate synthase	Back alignment and domain information

>PRK06144 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional	Back alignment and domain information

>PRK08259 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase	Back alignment and domain information

>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase	Back alignment and domain information

>PRK08321 naphthoate synthase; Validated	Back alignment and domain information

>PRK07260 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional	Back alignment and domain information

>PRK08260 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07509 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06072 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07327 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase	Back alignment and domain information

>PRK07827 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated	Back alignment and domain information

>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated	Back alignment and domain information

>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix	Back alignment and domain information

>PRK06023 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein	Back alignment and domain information

>PRK07854 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK05870 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated	Back alignment and domain information

>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism]	Back alignment and domain information

>PRK06190 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism]	Back alignment and domain information

>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed	Back alignment and domain information

>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ	Back alignment and domain information

>PRK08290 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK06213 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein	Back alignment and domain information

>PRK08272 enoyl-CoA hydratase; Provisional	Back alignment and domain information

>PRK08788 enoyl-CoA hydratase; Validated	Back alignment and domain information

>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism]	Back alignment and domain information

>PLN02988 3-hydroxyisobutyryl-CoA hydrolase	Back alignment and domain information

>PRK05869 enoyl-CoA hydratase; Validated	Back alignment and domain information

>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein	Back alignment and domain information

>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB	Back alignment and domain information

>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial	Back alignment and domain information

>PLN02267 enoyl-CoA hydratase/isomerase family protein	Back alignment and domain information

>PF13766 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PDB: 3JU1_A 3BPT_A	Back alignment and domain information

>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism]	Back alignment and domain information

>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase	Back alignment and domain information

>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase	Back alignment and domain information

>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional	Back alignment and domain information

>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein	Back alignment and domain information

>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily	Back alignment and domain information

>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease	Back alignment and domain information

>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type	Back alignment and domain information

>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification	Back alignment and domain information

>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type	Back alignment and domain information

>PRK11778 putative inner membrane peptidase; Provisional	Back alignment and domain information

>smart00250 PLEC Plectin repeat	Back alignment and domain information

>PF00681 Plectin: Plectin repeat; InterPro: IPR001101 Plectin may have a role in cross-linking intermediate filaments, in inter-linking intermediate filaments with microtubules and microfilaments and in anchoring intermediate filaments to the plasma and nuclear membranes	Back alignment and domain information

>PRK10949 protease 4; Provisional	Back alignment and domain information

>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional	Back alignment and domain information

>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional	Back alignment and domain information

>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional	Back alignment and domain information

>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit	Back alignment and domain information

>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated	Back alignment and domain information

>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase	Back alignment and domain information

>PRK05654 acetyl-CoA carboxylase subunit beta; Validated	Back alignment and domain information

>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		102
3moy_A		263	Crystal Structure Of Probable Enoyl-Coa Hydratase F		5e-05

>pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263

Back alignment and structure

Iteration: 1
 Score = 42.7 bits (99), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 6/90 (6%)
Query: 6   ITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALA 65
           +TAE+ ER GLV+ +V   +LL +A AVA+ + + ++      K  IN+  +  L   + 
Sbjct: 171 LTAEEAERVGLVSRIVPAADLLDEALAVAQRIARMSRPAGRAVKDAINEAFERPLSAGMR 230
Query: 66  LEKER------AHDYYNGMTKEQFKKMQEF 89
            E++        HD   GMT    K+  EF
Sbjct: 231 YERDAFYAMFDTHDQTEGMTAFLEKRTPEF 260

PyMOL of 3moy

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		102
3pe8_A		256	Enoyl-COA hydratase; emerald biostructures, struct	2e-16
2fbm_A		291	Y chromosome chromodomain protein 1, telomeric IS;	1e-14
2j5g_A		263	ALR4455 protein; enzyme evolution, C-C bond hydrol	5e-14
2j5i_A		276	P-hydroxycinnamoyl COA hydratase/lyase; vanillin,	1e-13
1sg4_A		260	3,2-trans-enoyl-COA isomerase, mitochondrial; crot	1e-13
3hin_A		275	Putative 3-hydroxybutyryl-COA dehydratase; structu	2e-13
2gtr_A		261	CDY-like, chromodomain Y-like protein; structural	2e-13
1uiy_A		253	Enoyl-COA hydratase; lyase, beta-oxidation, croton	3e-13
3rsi_A		265	Putative enoyl-COA hydratase/isomerase; structural	3e-13
3tlf_A		274	Enoyl-COA hydratase/isomerase; structural genomics	4e-13
3kqf_A		265	Enoyl-COA hydratase/isomerase family protein; IDP0	4e-13
4f47_A		278	Enoyl-COA hydratase ECHA19; ssgcid, seattle struct	6e-13
2ppy_A		265	Enoyl-COA hydratase; beta-oxidation, fatty acid me	6e-13
3qxz_A		265	Enoyl-COA hydratase/isomerase; structural genomics	7e-13
1ef8_A		261	Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc	7e-13
3r9q_A		262	Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome	1e-12
3pea_A		261	Enoyl-COA hydratase/isomerase family protein; stru	1e-12
2a7k_A		250	CARB; crotonase, antibiotic, beta-lactam, biosynth	1e-12
2q35_A		243	CURF; crotonase, lyase; 1.65A {Lyngbya majuscula}	1e-12
3lao_A		258	Enoyl-COA hydratase/isomerase; alpha-beta sandwich	1e-12
3qxi_A		265	Enoyl-COA hydratase ECHA1; structural genomics, se	2e-12
3swx_A		265	Probable enoyl-COA hydratase/isomerase; structural	2e-12
4di1_A		277	Enoyl-COA hydratase ECHA17; structural genomics, s	2e-12
3trr_A		256	Probable enoyl-COA hydratase/isomerase; ssgcid, st	2e-12
1mj3_A		260	Enoyl-COA hydratase, mitochondrial; homohexamer, l	2e-12
2pbp_A		258	Enoyl-COA hydratase subunit I; B-oxidation, struct	3e-12
3h81_A		278	Enoyl-COA hydratase ECHA8; niaid, decode, infectio	3e-12
3moy_A		263	Probable enoyl-COA hydratase; ssgcid, seattle stru	3e-12
1szo_A		257	6-oxocamphor hydrolase; enzyme-product complex; HE	4e-12
3r6h_A		233	Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m	4e-12
3isa_A		254	Putative enoyl-COA hydratase/isomerase; structural	8e-12
3g64_A		279	Putative enoyl-COA hydratase; alpha-beta structure	9e-12
3ot6_A		232	Enoyl-COA hydratase/isomerase family protein; stru	1e-11
1wz8_A		264	Enoyl-COA hydratase; lyase, crotonase, hexamer, st	1e-11
1nzy_A		269	Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen	1e-11
3l3s_A		263	Enoyl-COA hydratase/isomerase family protein; crot	2e-11
3qmj_A		256	Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid,	2e-11
3qre_A		298	Enoyl-COA hydratase, ECHA12_1; structural genomics	2e-11
3myb_A		286	Enoyl-COA hydratase; ssgcid, struct genomics, seat	2e-11
3p5m_A		255	Enoyl-COA hydratase/isomerase; seattle structural	3e-11
3gow_A		254	PAAG, probable enoyl-COA hydratase; the spiral fol	3e-11
2w3p_A		556	Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri	3e-11
2ej5_A		257	Enoyl-COA hydratase subunit II; structural genomic	3e-11
3rrv_A		276	Enoyl-COA hydratase/isomerase; structural genomics	3e-11
3t3w_A		279	Probable enoyl-COA hydratase; ssgcid, structural g	4e-11
2f6q_A		280	Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis	4e-11
3r9t_A		267	ECHA1_1; ssgcid, seattle structural genomics cente	5e-11
1hzd_A		272	AUH, AU-binding protein/enoyl-COA hydratase; RNA-b	5e-11
3lke_A		263	Enoyl-COA hydratase; nysgrc, target 11251J, struct	5e-11
3h0u_A		289	Putative enoyl-COA hydratase; structural genomics,	1e-10
3qk8_A		272	Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB	1e-10
2vx2_A		287	Enoyl-COA hydratase domain-containing protein 3; i	2e-10
3gkb_A		287	Putative enoyl-COA hydratase; structural genomics,	2e-10
3m6n_A		305	RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X	2e-10
2uzf_A		273	Naphthoate synthase; lyase, menaquinone biosynthes	1e-09
3i47_A		268	Enoyl COA hydratase/isomerase (crotonase); structu	2e-09
3t89_A		289	1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase	2e-09
3sll_A		290	Probable enoyl-COA hydratase/isomerase; structural	2e-09
3njd_A		333	Enoyl-COA hydratase; ssgcid, mycobacerium smegmati	3e-09
3t8b_A		334	1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase	4e-09
4eml_A		275	Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe	6e-09
1pjh_A		280	Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral	9e-09
3he2_A		264	Enoyl-COA hydratase ECHA6; fatty acid metabolism,	4e-08
2np9_A		440	DPGC; protein inhibitor complex, oxidoreductase; H	5e-08
3fdu_A		266	Putative enoyl-COA hydratase/isomerase; structural	5e-08
1dci_A		275	Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg	2e-07
3hp0_A		267	Putative polyketide biosynthesis enoyl-COA hydrata	7e-06
3oc7_A		267	Enoyl-COA hydratase; seattle structural genomics c	1e-05

>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256	Back alignment and structure

 Score = 70.7 bits (174), Expect = 2e-16
 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 1/90 (1%)

Query: 5   PITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHAL 64
            ++A+   R GLV  VV   +LL  A  VA +++ NNQ  V       +    L  G AL
Sbjct: 162 YLSAQDALRAGLVTEVVAHDDLLTAARRVAASIVGNNQKAVRALLDSYHRIDALQTGGAL 221

Query: 65  ALEKERAHDYYNGMTKEQFKK-MQEFIAAR 93
             E E A  +    + +         I   
Sbjct: 222 WAEAEAARQWMRSTSGDDIAASRASVIERG 251

PyMOL of 3pe8

>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291	Back alignment and structure

>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263	Back alignment and structure

>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276	Back alignment and structure

>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260	Back alignment and structure

>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275	Back alignment and structure

>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261	Back alignment and structure

>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253	Back alignment and structure

>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265	Back alignment and structure

>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274	Back alignment and structure

>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265	Back alignment and structure

>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278	Back alignment and structure

>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265	Back alignment and structure

>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265	Back alignment and structure

>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261	Back alignment and structure

>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262	Back alignment and structure

>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261	Back alignment and structure

>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250	Back alignment and structure

>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243	Back alignment and structure

>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258	Back alignment and structure

>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265	Back alignment and structure

>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265	Back alignment and structure

>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277	Back alignment and structure

>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256	Back alignment and structure

>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260	Back alignment and structure

>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258	Back alignment and structure

>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278	Back alignment and structure

>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263	Back alignment and structure

>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257	Back alignment and structure

>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233	Back alignment and structure

>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254	Back alignment and structure

>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279	Back alignment and structure

>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232	Back alignment and structure

>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264	Back alignment and structure

>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269	Back alignment and structure

>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263	Back alignment and structure

>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256	Back alignment and structure

>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298	Back alignment and structure

>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286	Back alignment and structure

>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255	Back alignment and structure

>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556	Back alignment and structure

>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257	Back alignment and structure

>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276	Back alignment and structure

>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279	Back alignment and structure

>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280	Back alignment and structure

>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267	Back alignment and structure

>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272	Back alignment and structure

>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263	Back alignment and structure

>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289	Back alignment and structure

>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272	Back alignment and structure

>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287	Back alignment and structure

>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287	Back alignment and structure

>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305	Back alignment and structure

>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273	Back alignment and structure

>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268	Back alignment and structure

>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289	Back alignment and structure

>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290	Back alignment and structure

>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333	Back alignment and structure

>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334	Back alignment and structure

>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275	Back alignment and structure

>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280	Back alignment and structure

>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264	Back alignment and structure

>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440	Back alignment and structure

>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266	Back alignment and structure

>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275	Back alignment and structure

>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267	Back alignment and structure

>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		102
3hrx_A		254	Probable enoyl-COA hydratase; the spiral fold, the	99.91
4fzw_A		258	2,3-dehydroadipyl-COA hydratase; structural genomi	99.9
4fzw_C		274	1,2-epoxyphenylacetyl-COA isomerase; structural ge	99.9
3trr_A		256	Probable enoyl-COA hydratase/isomerase; ssgcid, st	99.89
3gow_A		254	PAAG, probable enoyl-COA hydratase; the spiral fol	99.89
3moy_A		263	Probable enoyl-COA hydratase; ssgcid, seattle stru	99.89
3kqf_A		265	Enoyl-COA hydratase/isomerase family protein; IDP0	99.88
3swx_A		265	Probable enoyl-COA hydratase/isomerase; structural	99.88
3h81_A		278	Enoyl-COA hydratase ECHA8; niaid, decode, infectio	99.88
3rsi_A		265	Putative enoyl-COA hydratase/isomerase; structural	99.88
3sll_A		290	Probable enoyl-COA hydratase/isomerase; structural	99.88
3p5m_A		255	Enoyl-COA hydratase/isomerase; seattle structural	99.88
3g64_A		279	Putative enoyl-COA hydratase; alpha-beta structure	99.88
3qxi_A		265	Enoyl-COA hydratase ECHA1; structural genomics, se	99.88
3myb_A		286	Enoyl-COA hydratase; ssgcid, struct genomics, seat	99.88
3pea_A		261	Enoyl-COA hydratase/isomerase family protein; stru	99.88
4f47_A		278	Enoyl-COA hydratase ECHA19; ssgcid, seattle struct	99.88
3tlf_A		274	Enoyl-COA hydratase/isomerase; structural genomics	99.87
3i47_A		268	Enoyl COA hydratase/isomerase (crotonase); structu	99.87
3qxz_A		265	Enoyl-COA hydratase/isomerase; structural genomics	99.87
1nzy_A		269	Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen	99.87
3r9t_A		267	ECHA1_1; ssgcid, seattle structural genomics cente	99.87
3hin_A		275	Putative 3-hydroxybutyryl-COA dehydratase; structu	99.87
1mj3_A		260	Enoyl-COA hydratase, mitochondrial; homohexamer, l	99.87
2pbp_A		258	Enoyl-COA hydratase subunit I; B-oxidation, struct	99.86
2ej5_A		257	Enoyl-COA hydratase subunit II; structural genomic	99.86
2ppy_A		265	Enoyl-COA hydratase; beta-oxidation, fatty acid me	99.86
4hdt_A		353	3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti	99.86
2vx2_A		287	Enoyl-COA hydratase domain-containing protein 3; i	99.86
1uiy_A		253	Enoyl-COA hydratase; lyase, beta-oxidation, croton	99.85
2fbm_A		291	Y chromosome chromodomain protein 1, telomeric IS;	99.85
3r9q_A		262	Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome	99.85
1dci_A		275	Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg	99.85
3qre_A		298	Enoyl-COA hydratase, ECHA12_1; structural genomics	99.85
1ef8_A		261	Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc	99.84
1wz8_A		264	Enoyl-COA hydratase; lyase, crotonase, hexamer, st	99.84
3oc7_A		267	Enoyl-COA hydratase; seattle structural genomics c	99.84
2gtr_A		261	CDY-like, chromodomain Y-like protein; structural	99.84
4eml_A		275	Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe	99.83
3fdu_A		266	Putative enoyl-COA hydratase/isomerase; structural	99.83
2uzf_A		273	Naphthoate synthase; lyase, menaquinone biosynthes	99.83
2j5i_A		276	P-hydroxycinnamoyl COA hydratase/lyase; vanillin,	99.82
3qk8_A		272	Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB	99.82
3t89_A		289	1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase	99.82
1hzd_A		272	AUH, AU-binding protein/enoyl-COA hydratase; RNA-b	99.82
3lke_A		263	Enoyl-COA hydratase; nysgrc, target 112 structural	99.81
3t8b_A		334	1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase	99.81
1sg4_A		260	3,2-trans-enoyl-COA isomerase, mitochondrial; crot	99.8
3bpt_A		363	3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet	99.8
3ju1_A		407	Enoyl-COA hydratase/isomerase family protein; alph	99.8
2f6q_A		280	Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis	99.8
3qmj_A		256	Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid,	99.8
3hp0_A		267	Putative polyketide biosynthesis enoyl-COA hydrata	99.8
3isa_A		254	Putative enoyl-COA hydratase/isomerase; structural	99.79
3pe8_A		256	Enoyl-COA hydratase; emerald biostructures, struct	99.78
3gkb_A		287	Putative enoyl-COA hydratase; structural genomics,	99.78
3he2_A		264	Enoyl-COA hydratase ECHA6; fatty acid metabolism,	99.77
2a7k_A		250	CARB; crotonase, antibiotic, beta-lactam, biosynth	99.77
3h0u_A		289	Putative enoyl-COA hydratase; structural genomics,	99.76
3rrv_A		276	Enoyl-COA hydratase/isomerase; structural genomics	99.76
3lao_A		258	Enoyl-COA hydratase/isomerase; alpha-beta sandwich	99.76
3l3s_A		263	Enoyl-COA hydratase/isomerase family protein; crot	99.75
4di1_A		277	Enoyl-COA hydratase ECHA17; structural genomics, s	99.71
2q35_A		243	CURF; crotonase, lyase; 1.65A {Lyngbya majuscula}	99.69
3njd_A		333	Enoyl-COA hydratase; ssgcid, mycobacerium smegmati	99.67
2j5g_A		263	ALR4455 protein; enzyme evolution, C-C bond hydrol	99.61
3m6n_A		305	RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X	99.61
3ot6_A		232	Enoyl-COA hydratase/isomerase family protein; stru	99.59
2wtb_A		725	MFP2, fatty acid multifunctional protein (ATMFP2);	99.59
1pjh_A		280	Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral	99.54
1wdk_A		715	Fatty oxidation complex alpha subunit; alpha2BETA2	99.54
3r6h_A		233	Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m	99.54
3zwc_A		742	Peroxisomal bifunctional enzyme; beta oxidation pa	99.49
2np9_A		440	DPGC; protein inhibitor complex, oxidoreductase; H	99.49
1szo_A		257	6-oxocamphor hydrolase; enzyme-product complex; HE	99.43
3t3w_A		279	Enoyl-COA hydratase; ssgcid, structural genomics,	99.39
2w3p_A		556	Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri	98.49
3bf0_A		593	Protease 4; bacterial, hydrolase, inner membrane,	97.13
3rst_A		240	Signal peptide peptidase SPPA; alpha/beta protein	97.03
3viv_A		230	441AA long hypothetical NFED protein; protein-pept	96.74
2f9y_B		304	Acetyl-coenzyme A carboxylase carboxyl transferas	96.6
2cby_A		208	ATP-dependent CLP protease proteolytic subunit 1;	95.61
2f9i_A		327	Acetyl-coenzyme A carboxylase carboxyl transferase	95.6
2f9y_A		339	Acetyl-COA carboxylase, carboxyltransferase alpha;	95.22
2w3p_A		556	Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri	94.42
2f6i_A		215	ATP-dependent CLP protease, putative; structural g	92.76
3qwd_A		203	ATP-dependent CLP protease proteolytic subunit; ca	92.75
1tg6_A		277	Putative ATP-dependent CLP protease proteolytic S;	91.83
3bf0_A		593	Protease 4; bacterial, hydrolase, inner membrane,	89.97

>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus}	Back alignment and structure

Probab=99.91  E-value=1.3e-23  Score=136.90  Aligned_cols=98  Identities=21%  Similarity=0.283  Sum_probs=94.1

Q ss_pred             CCCcccCHHHHHhccccceecCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhcCCHHHHHHHHHHHHhHHhhcCCh
Q 034158            1 MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTK   80 (102)
Q Consensus         1 ltg~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~~~~l~~~~~~a~~~~K~~i~~~~~~~~~~~~~~e~~~~~~~~~~~~~   80 (102)
                      +||++|+|+||+++||||+|||++++++.+.+++..|+..||.++..+|++++.....++++++..|...+..++.  ++
T Consensus       157 ltg~~i~A~eA~~~GLv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K~~~~~~~~~~~~~~l~~e~~~~~~~~~--s~  234 (254)
T 3hrx_A          157 LLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQ--TQ  234 (254)
T ss_dssp             HHCCCEEHHHHHHHTSCSEEECGGGHHHHHHHHHHHHHTSCHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHHT--SH
T ss_pred             hcCcccCHHHHHHCCCeEEecCcHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhC--CH
Confidence            5899999999999999999999999999999999999999999999999999999999999999999999998884  99


Q ss_pred             hHHHHHHHHHhhcCCCCCCC
Q 034158           81 EQFKKMQEFIAARSSKKPSS  100 (102)
Q Consensus        81 ~~~~~i~~fl~k~~~~~~~~  100 (102)
                      |+++++++|++||+|.|+++
T Consensus       235 d~~Eg~~AF~eKR~P~f~Gr  254 (254)
T 3hrx_A          235 DHEEGVRAFREKRPPRFQGR  254 (254)
T ss_dssp             HHHHHHHHHHTTSCCCCCCC
T ss_pred             HHHHHHHHHhCCCCCCCCCC
Confidence            99999999999999999874

PyMOL of 3hrx

>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli}	Back alignment and structure

>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli}	Back alignment and structure

>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus}	Back alignment and structure

>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis}	Back alignment and structure

>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis}	Back alignment and structure

>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus}	Back alignment and structure

>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A*	Back alignment and structure

>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus}	Back alignment and structure

>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus}	Back alignment and structure

>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium}	Back alignment and structure

>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3}	Back alignment and structure

>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum}	Back alignment and structure

>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis}	Back alignment and structure

>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis}	Back alignment and structure

>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum}	Back alignment and structure

>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0	Back alignment and structure

>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0	Back alignment and structure

>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0	Back alignment and structure

>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B*	Back alignment and structure

>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A	Back alignment and structure

>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris}	Back alignment and structure

>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A*	Back alignment and structure

>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A	Back alignment and structure

>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus}	Back alignment and structure

>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus}	Back alignment and structure

>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile}	Back alignment and structure

>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens}	Back alignment and structure

>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3	Back alignment and structure

>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3	Back alignment and structure

>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A	Back alignment and structure

>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A	Back alignment and structure

>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M}	Back alignment and structure

>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A*	Back alignment and structure

>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3	Back alignment and structure

>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0	Back alignment and structure

>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A	Back alignment and structure

>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP}	Back alignment and structure

>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii}	Back alignment and structure

>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus}	Back alignment and structure

>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C*	Back alignment and structure

>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A	Back alignment and structure

>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A	Back alignment and structure

>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A	Back alignment and structure

>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans}	Back alignment and structure

>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A	Back alignment and structure

>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A	Back alignment and structure

>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens}	Back alignment and structure

>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis}	Back alignment and structure

>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3	Back alignment and structure

>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum}	Back alignment and structure

>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis}	Back alignment and structure

>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis}	Back alignment and structure

>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A	Back alignment and structure

>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis}	Back alignment and structure

>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis}	Back alignment and structure

>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A*	Back alignment and structure

>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis}	Back alignment and structure

>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp}	Back alignment and structure

>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi}	Back alignment and structure

>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum}	Back alignment and structure

>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A	Back alignment and structure

>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A	Back alignment and structure

>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D	Back alignment and structure

>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A	Back alignment and structure

>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV}	Back alignment and structure

>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana}	Back alignment and structure

>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A	Back alignment and structure

>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A*	Back alignment and structure

>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A*	Back alignment and structure

>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A*	Back alignment and structure

>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A*	Back alignment and structure

>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A	Back alignment and structure

>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A	Back alignment and structure

>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans}	Back alignment and structure

>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A	Back alignment and structure

>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis}	Back alignment and structure

>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A	Back alignment and structure

>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4	Back alignment and structure

>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A	Back alignment and structure

>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus}	Back alignment and structure

>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4	Back alignment and structure

>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans}	Back alignment and structure

>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1	Back alignment and structure

>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A	Back alignment and structure

>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1	Back alignment and structure

>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		102
d1pjha_		266	c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2	2e-07
d1szoa_		249	c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus	7e-04

>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 45.1 bits (105), Expect = 2e-07
 Identities = 12/92 (13%), Positives = 28/92 (30%), Gaps = 7/92 (7%)

Query: 1   MAATPITAEQGERWGLVNHVVEEGELLKKAHA------VAEAMIKNNQDLVLRYKAVIND 54
           M   P   +     G ++          +A        + E +        L  K ++  
Sbjct: 175 MFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKS 234

Query: 55  GLKLDLGHALALE-KERAHDYYNGMTKEQFKK 85
                   A ++E  E    + +G   ++F++
Sbjct: 235 NHIDAFNKANSVEVNESLKYWVDGEPLKRFRQ 266

PyMOL of d1pjha_

>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		102
d1nzya_		269	4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp.,	99.89
d2fw2a1		258	Chromodomain protein CDY2A {Human (Homo sapiens) [	99.88
d1wz8a1		263	Probable enoyl-CoA hydratase TTHA0218 {Thermus the	99.86
d1mj3a_		260	Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve	99.86
d1dcia_		275	Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso	99.86
d1uiya_		253	Enoyl-CoA hydratase (crotonase) {Thermus thermophi	99.86
d1hzda_		266	AUH protein {Human (Homo sapiens) [TaxId: 9606]}	99.85
d1q52a_		297	Naphthoate synthase MenB {Mycobacterium tuberculos	99.83
d1ef8a_		261	Methylmalonyl CoA decarboxylase {Escherichia coli	99.83
d2f6qa1		245	Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (	99.64
d1wdka4		310	Fatty oxidation complex alpha subunit, N-terminal	99.61
d1sg4a1		249	Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso	99.59
d2a7ka1		230	Carbapenem biosynthes protein CarB {Pectobacterium	99.49
d1szoa_		249	6-oxo camphor hydrolase {Rhodococcus erythropolis	99.39
d1pjha_		266	Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso	99.02

>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: 4-Chlorobenzoyl-CoA dehalogenase
species: Pseudomonas sp., strain CBS-3 [TaxId: 306]

Probab=99.89  E-value=6.8e-23  Score=132.86  Aligned_cols=99  Identities=16%  Similarity=0.280  Sum_probs=94.4

Q ss_pred             CCCcccCHHHHHhccccceecCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhhcCCHHHHHHHHHHHHhHHhhcCCh
Q 034158            1 MAATPITAEQGERWGLVNHVVEEGELLKKAHAVAEAMIKNNQDLVLRYKAVINDGLKLDLGHALALEKERAHDYYNGMTK   80 (102)
Q Consensus         1 ltg~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~~~~l~~~~~~a~~~~K~~i~~~~~~~~~~~~~~e~~~~~~~~~~~~~   80 (102)
                      +||+.++|+||+++||||+|||++++.+.+.++++.|++.||.++..+|+.++.....+++++++.|...+...+.  ++
T Consensus       166 ltg~~i~a~eA~~~Glv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K~~l~~~~~~~l~~~~~~e~~~~~~~~~--~~  243 (269)
T d1nzya_         166 LTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVMAKERFHAGWMQPVEECTEFEIQNVIASVT--HP  243 (269)
T ss_dssp             HHCCCBCHHHHHHHTSCSCEECHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHH--ST
T ss_pred             ccccccchhHHHHcCCccccccccccccchhhhhhhhhhhhHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhc--CH
Confidence            4799999999999999999999999999999999999999999999999999999889999999999999999885  99


Q ss_pred             hHHHHHHHHHhhcCCCCCCCC
Q 034158           81 EQFKKMQEFIAARSSKKPSSK  101 (102)
Q Consensus        81 ~~~~~i~~fl~k~~~~~~~~~  101 (102)
                      +++++|.+|++|++|+|++..
T Consensus       244 ~~~e~v~aflekrkp~~~~~~  264 (269)
T d1nzya_         244 HFMPCLTRFLDGHRADRPQVE  264 (269)
T ss_dssp             THHHHHHHHHTTCCTTCCSSC
T ss_pred             HHHHHHHHHHCCCCCCcCCCC
Confidence            999999999999999998764

PyMOL of d1nzya_

>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]}	Back information, alignment and structure

>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}	Back information, alignment and structure

>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]}	Back information, alignment and structure

>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure