Citrus Sinensis ID: 034274

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MGNLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELWSASCY
ccccccccEEEEEEEcccccEEEEEEEcccccccccccccEEcccccEEEEEHHcccEEEEEEEEcccEEEEEEEcEEHHHHHHHHHcccccccccccc
cccccccEEEcEEEcccccccEEEEEEccccHHHHHccccEccccccEEEEEEccccccEEEEEEcccEEEEEccEccHHHHHHHHHHHHHHHHccccc
mgnlslgkildclcisspgscscfclntfegqdefekkplmksdggqllrlkdvvsgnqtlafqlkpKMVVVIGDIIPFEVLESVSKVKNAELWSASCY
MGNLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQTlafqlkpkmvVVIGDIIPFevlesvskvknaelwsascy
MGNLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELWSASCY
*****LGKILDCLCISSPGSCSCFCLNTFEGQD************GQLLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELW*****
****SLG*ILDCLCISSPGSCSCFCLNTF*******************LRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELWSASC*
MGNLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELWSASCY
***LSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELWSASCY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNLSLGKILDCLCISSPGSCSCFCLNTFEGQDEFEKKPLMKSDGGQLLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKVKNAELWSASCY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
224143487138 predicted protein [Populus trichocarpa] 0.969 0.695 0.555 2e-30
255549056136 chloroplast-targeted copper chaperone, p 0.959 0.698 0.533 5e-28
225445302134 PREDICTED: uncharacterized protein LOC10 0.939 0.694 0.515 7e-26
357500407135 hypothetical protein MTR_6g086020 [Medic 0.909 0.666 0.484 3e-22
356520571135 PREDICTED: uncharacterized protein LOC10 0.898 0.659 0.488 4e-22
217070984135 unknown [Medicago truncatula] 0.919 0.674 0.472 2e-21
356513125132 PREDICTED: uncharacterized protein LOC10 0.959 0.719 0.496 2e-21
357521067132 hypothetical protein MTR_8g103820 [Medic 0.919 0.689 0.484 1e-20
356531236135 PREDICTED: uncharacterized protein LOC10 0.898 0.659 0.464 4e-20
388495864135 unknown [Lotus japonicus] 0.919 0.674 0.449 2e-19
>gi|224143487|ref|XP_002324972.1| predicted protein [Populus trichocarpa] gi|222866406|gb|EEF03537.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  135 bits (341), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 89/135 (65%), Gaps = 39/135 (28%)

Query: 1   MGNLSLGKILDCLCISSPGS-CSCFCLNTFEGQDE-FEKKPLMKSDGGQLLRLKDVVSGN 58
           MG LSLGK+LDCLC ++PGS CSCFC+N+ + QD+ FEKKPL+ SD G+L+RLKDVV+ N
Sbjct: 1   MGKLSLGKVLDCLCFTTPGSSCSCFCINSLDSQDDGFEKKPLIPSDKGRLVRLKDVVADN 60

Query: 59  QTLAFQLKP-------------------------------------KMVVVIGDIIPFEV 81
           QTLAFQLKP                                     KMVVVIGDIIPFEV
Sbjct: 61  QTLAFQLKPKMVVLRVSMHCNGCARKVKKHVSKMEGVSSYKVDLESKMVVVIGDIIPFEV 120

Query: 82  LESVSKVKNAELWSA 96
           LESVS+VKNAELW++
Sbjct: 121 LESVSRVKNAELWNS 135

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255549056|ref|XP_002515584.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] gi|223545528|gb|EEF47033.1| chloroplast-targeted copper chaperone, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225445302|ref|XP_002284677.1| PREDICTED: uncharacterized protein LOC100244080 [Vitis vinifera] gi|297738856|emb|CBI28101.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357500407|ref|XP_003620492.1| hypothetical protein MTR_6g086020 [Medicago truncatula] gi|355495507|gb|AES76710.1| hypothetical protein MTR_6g086020 [Medicago truncatula] gi|388493690|gb|AFK34911.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356520571|ref|XP_003528935.1| PREDICTED: uncharacterized protein LOC100795735 [Glycine max] Back     alignment and taxonomy information
>gi|217070984|gb|ACJ83852.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356513125|ref|XP_003525264.1| PREDICTED: uncharacterized protein LOC100816650 [Glycine max] Back     alignment and taxonomy information
>gi|357521067|ref|XP_003630822.1| hypothetical protein MTR_8g103820 [Medicago truncatula] gi|355524844|gb|AET05298.1| hypothetical protein MTR_8g103820 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356531236|ref|XP_003534184.1| PREDICTED: uncharacterized protein LOC100788037 [Glycine max] Back     alignment and taxonomy information
>gi|388495864|gb|AFK35998.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
TAIR|locus:2094864140 AT3G24450 "AT3G24450" [Arabido 0.696 0.492 0.506 3.4e-23
TAIR|locus:2049731259 NAKR2 "AT2G37390" [Arabidopsis 0.444 0.169 0.479 5.4e-05
TAIR|locus:2065526265 AT2G28660 "AT2G28660" [Arabido 0.434 0.162 0.418 6e-05
TAIR|locus:2181718319 NAKR1 "SODIUM POTASSIUM ROOT D 0.434 0.134 0.489 0.00059
TAIR|locus:2094864 AT3G24450 "AT3G24450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 3.4e-23, Sum P(2) = 3.4e-23
 Identities = 39/77 (50%), Positives = 55/77 (71%)

Query:     1 MGNLS-LGKILDCLCISSPGSCSCFCLNTF-EGQDEFEKKPLMKSD---GGQLLRLKDVV 55
             MG L  +G++ DCL + +   CSCFCLNT  + ++EFEK+PL+ S     G+++RLKDVV
Sbjct:     1 MGKLQKIGRVWDCLFLPT-NQCSCFCLNTLGDEEEEFEKEPLIDSSTEKSGKVMRLKDVV 59

Query:    56 SGN--QTLAFQLKPKMV 70
             + +  QTLAF LKPK+V
Sbjct:    60 AADHRQTLAFHLKPKIV 76
GO:0005507 "copper ion binding" evidence=ISS
GO:0006825 "copper ion transport" evidence=ISS
GO:0030001 "metal ion transport" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
TAIR|locus:2049731 NAKR2 "AT2G37390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065526 AT2G28660 "AT2G28660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181718 NAKR1 "SODIUM POTASSIUM ROOT DEFECTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0020002701
hypothetical protein (139 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
KOG160373 consensus Copper chaperone [Inorganic ion transpor 99.16
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 97.28
KOG4656 247 consensus Copper chaperone for superoxide dismutas 95.75
COG260871 CopZ Copper chaperone [Inorganic ion transport and 93.71
PLN02957 238 copper, zinc superoxide dismutase 86.07
>KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.16  E-value=2.3e-11  Score=78.33  Aligned_cols=50  Identities=28%  Similarity=0.560  Sum_probs=44.6

Q ss_pred             eEEeccccCCceeEEEeecCCeEEEEEecCHHHHHHHhhhc--cccccCCCC
Q 034274           48 LLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKV--KNAELWSAS   97 (99)
Q Consensus        48 ~~rvk~~v~GV~sv~vd~k~qKVTVtG~Vdp~eVL~~V~Kt--K~AelWp~p   97 (99)
                      ++|+...++||.++.+|.++|+|||+|+++|..||+.++|+  |++++|..|
T Consensus        22 V~~~l~~~~GV~~v~id~~~~kvtV~g~~~p~~vl~~l~k~~~k~~~~~~~p   73 (73)
T KOG1603|consen   22 VKRVLQKLKGVESVDIDIKKQKVTVKGNVDPVKLLKKLKKTGGKRAELWKVP   73 (73)
T ss_pred             HHHHhhccCCeEEEEecCCCCEEEEEEecCHHHHHHHHHhcCCCceEEecCC
Confidence            45555567899999999999999999999999999999987  889999766

>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02957 copper, zinc superoxide dismutase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
3iwl_A68 Copper transport protein ATOX1; beta-alpha-beta-BE 97.88
1cc8_A73 Protein (metallochaperone ATX1); copper transport, 97.75
2crl_A98 Copper chaperone for superoxide dismutase; SOD1, f 97.51
4a4j_A69 Pacszia, cation-transporting ATPase PACS; hydrolas 96.82
3dxs_X74 Copper-transporting ATPase RAN1; CXXC motif, ferre 96.6
2xmm_A64 SSR2857 protein, ATX1; metal transport, copper hom 96.42
1q8l_A84 Copper-transporting ATPase 1; metal binding protei 96.36
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 96.32
1qup_A 222 Superoxide dismutase 1 copper chaperone; two domai 96.18
2roe_A66 Heavy metal binding protein; NMR {Thermus thermoph 96.14
2k2p_A85 Uncharacterized protein ATU1203; putative metal-bi 95.56
1jk9_B 249 CCS, copper chaperone for superoxide dismutase; pr 95.26
1fvq_A72 Copper-transporting ATPase; APO-CCC2A, hydrolase; 94.75
1aw0_A72 Menkes copper-transporting ATPase; copper-binding 94.28
1cpz_A68 Protein (COPZ); copper chaperone, metal transport, 94.17
2xmw_A71 PACS-N, cation-transporting ATPase PACS; hydrolase 94.1
2ew9_A149 Copper-transporting ATPase 2; copper trafficking, 94.05
2g9o_A90 Copper-transporting ATPase 1; menkes disease, solu 94.03
2l3m_A71 Copper-ION-binding protein; structural genomics, c 93.88
1osd_A72 MERP, hypothetical protein MERP; mercury resistanc 93.86
1p6t_A151 Potential copper-transporting ATPase; COPA, P-type 93.82
1yg0_A66 COP associated protein; open-faced beta-sandwich, 93.71
3cjk_B75 Copper-transporting ATPase 1; HAH1, ATP7B, menkes 93.56
1opz_A76 Potential copper-transporting ATPase; mutation, fo 93.44
2kt2_A69 Mercuric reductase; nmera, MERA, HMA domain, mercu 93.28
1yjr_A75 Copper-transporting ATPase 1; metallochaperone, pr 92.97
2qif_A69 Copper chaperone COPZ; tetranuclear Cu(I) cluster; 92.62
1y3j_A77 Copper-transporting ATPase 1; ferrodoxin-like fold 91.77
2ldi_A71 Zinc-transporting ATPase; metal homeostasis, metal 91.26
1kvi_A79 Copper-transporting ATPase 1; menkes, Cu-protein, 91.0
2ofg_X111 Zinc-transporting ATPase; ferredoxin-like fold, be 90.5
1mwy_A73 ZNTA; open-faced beta-sandwich fold, beta-alpha-be 90.24
2kkh_A95 Putative heavy metal transporter; zinc transport, 90.15
2aj0_A71 Probable cadmium-transporting ATPase; ferrodoxin-l 89.0
2rop_A202 Copper-transporting ATPase 2; wilson protein, mobi 88.63
2kyz_A67 Heavy metal binding protein; structural genomics, 88.11
1jww_A80 Potential copper-transporting ATPase; beta-alpha-b 88.03
>3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Back     alignment and structure
Probab=97.88  E-value=1.4e-05  Score=47.36  Aligned_cols=42  Identities=17%  Similarity=0.174  Sum_probs=38.7

Q ss_pred             ccCCceeEEEeecCCeEEEEEecCHHHHHHHhhhc-cccccCCC
Q 034274           54 VVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKV-KNAELWSA   96 (99)
Q Consensus        54 ~v~GV~sv~vd~k~qKVTVtG~Vdp~eVL~~V~Kt-K~AelWp~   96 (99)
                      .++|| ++++|+..++++|.+.++++++++.|++. ..+++|..
T Consensus        25 ~~~gV-~v~v~~~~~~~~v~~~~~~~~i~~~i~~~Gy~~~~~~~   67 (68)
T 3iwl_A           25 KLGGV-KYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGL   67 (68)
T ss_dssp             HHCSE-EEEEETTTTEEEEEESSCHHHHHHHHHTTCSCEEEEEC
T ss_pred             cCCCe-EEEEEcCCCEEEEEecCCHHHHHHHHHHcCCceEecCC
Confidence            46899 99999999999999999999999999999 88998853
>1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Back     alignment and structure
>2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A Back     alignment and structure
>3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 Back     alignment and structure
>2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Back     alignment and structure
>1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Back     alignment and structure
>2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Back     alignment and structure
>1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Back     alignment and structure
>1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B Back     alignment and structure
>1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A Back     alignment and structure
>1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 Back     alignment and structure
>2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A Back     alignment and structure
>2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Back     alignment and structure
>2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Back     alignment and structure
>2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Back     alignment and structure
>1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Back     alignment and structure
>1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Back     alignment and structure
>1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Back     alignment and structure
>3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Back     alignment and structure
>1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A Back     alignment and structure
>2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A Back     alignment and structure
>1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A Back     alignment and structure
>2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Back     alignment and structure
>1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A Back     alignment and structure
>2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} Back     alignment and structure
>1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Back     alignment and structure
>1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A Back     alignment and structure
>2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} Back     alignment and structure
>2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A Back     alignment and structure
>2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Back     alignment and structure
>2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} Back     alignment and structure
>1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d1qupa272 Copper chaperone for superoxide dismutase, N-termi 98.6
d1fe0a_66 ATX1 metallochaperone protein (ATOX1) {Human (Homo 98.46
d1cc8a_72 ATX1 metallochaperone protein (ATOX1) {Baker's yea 98.28
d1sb6a_64 Copper chaperone {Synechocystis sp. pcc 6803, Scat 97.49
d2ggpb172 Copper transporter domain ccc2a {Baker's yeast (Sa 96.9
d1cpza_68 Copper chaperone {Enterococcus hirae [TaxId: 1354] 96.7
d1osda_72 Mercuric ion binding protein MerP {Ralstonia metal 96.69
d1q8la_84 Menkes copper-transporting ATPase {Human (Homo sap 95.88
d2aw0a_72 Menkes copper-transporting ATPase {Human (Homo sap 95.81
d1p6ta279 Potential copper-translocating P-type ATPase CopA 95.75
d2qifa169 Copper chaperone {Bacillus subtilis, CopZ [TaxId: 95.64
d1p6ta172 Potential copper-translocating P-type ATPase CopA 95.5
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 95.38
d1mwza_73 Metal ion-transporting ATPase ZntA, N-terminal dom 95.12
>d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: HMA, heavy metal-associated domain
family: HMA, heavy metal-associated domain
domain: Copper chaperone for superoxide dismutase, N-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.60  E-value=1.2e-08  Score=63.22  Aligned_cols=48  Identities=17%  Similarity=0.353  Sum_probs=42.8

Q ss_pred             eEEeccccCCceeEEEeecCCeEEEEEecCHHHHHHHhhhc-cccccCC
Q 034274           48 LLRLKDVVSGNQTLAFQLKPKMVVVIGDIIPFEVLESVSKV-KNAELWS   95 (99)
Q Consensus        48 ~~rvk~~v~GV~sv~vd~k~qKVTVtG~Vdp~eVL~~V~Kt-K~AelWp   95 (99)
                      +.+.-..++||+++.||++.++|+|.|.++|+++++.|+++ +.|.+|.
T Consensus        23 Iek~l~~~~gV~~v~vdl~~~~v~V~~~~~~~~i~~~I~~~G~~A~l~g   71 (72)
T d1qupa2          23 IKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRG   71 (72)
T ss_dssp             HHHHHTTCTTEEEEEEETTTTEEEEEESSCHHHHHHHHHHTTCCCEEEC
T ss_pred             HHHHHhcCCCeeEEEEECCCCEEEEEeeCCHHHHHHHHHHhCCCEEEec
Confidence            44444557999999999999999999999999999999999 9999874
>d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Back     information, alignment and structure
>d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Back     information, alignment and structure
>d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Back     information, alignment and structure
>d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Back     information, alignment and structure
>d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Back     information, alignment and structure
>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure