Citrus Sinensis ID: 034276


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
cEEEEEEcccHHHHHccEEEEEEEEccccccccccHHHHHHHHHHHccccccccccccccccccEEEEEcccccEEEcccccEEccccEEEEEEccccc
ccEEEEEccHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHcccHHEEcccccccEEEEEEEcccEEEcccccEEEccccEEEEEEEcccc
mqltlefgggLELLCDSvkvhnvdvvppkgsekLIMKDLLSWVGTnlikerpemfmkgdsvrpgvlVLVNdcdwelsgqldttleeKDVVVFISTLHGG
MQLTLEFGGGLELLCDSVKVHNVDvvppkgseklimKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELsgqldttleekdVVVFISTLHGG
MQltlefggglellCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
****LEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTL***
MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHG*
MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLH**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query99 2.2.26 [Sep-21-2011]
B3H7G299 Ubiquitin-related modifie yes no 1.0 1.0 0.828 3e-41
A0MDQ1101 Ubiquitin-related modifie no no 1.0 0.980 0.811 1e-39
Q0D6M1100 Ubiquitin-related modifie yes no 1.0 0.99 0.76 7e-36
Q7GBC8100 Ubiquitin-related modifie N/A no 1.0 0.99 0.76 7e-36
B6SXH2101 Ubiquitin-related modifie N/A no 1.0 0.980 0.762 2e-34
Q5ZJU4101 Ubiquitin-related modifie yes no 0.959 0.940 0.587 6e-27
A9YUB5101 Ubiquitin-related modifie N/A no 0.979 0.960 0.575 4e-26
Q148F0101 Ubiquitin-related modifie yes no 0.979 0.960 0.575 4e-26
Q9BTM9101 Ubiquitin-related modifie yes no 0.979 0.960 0.555 6e-26
Q9D2P4101 Ubiquitin-related modifie yes no 0.959 0.940 0.567 9e-26
>sp|B3H7G2|URM12_ARATH Ubiquitin-related modifier 1 homolog 2 OS=Arabidopsis thaliana GN=URM1-2 PE=3 SV=1 Back     alignment and function desciption
 Score =  167 bits (422), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/99 (82%), Positives = 89/99 (89%)

Query: 1  MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
          MQ TLEFGGGLELLCDSVK+H V++     S+ L MKDLLSWV TNLIKERPEMFMKGD+
Sbjct: 1  MQFTLEFGGGLELLCDSVKIHKVNINLLNDSDILTMKDLLSWVRTNLIKERPEMFMKGDT 60

Query: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
          VRPGVLVLVNDCDWELSGQLDTTLE+KDV+VFISTLHGG
Sbjct: 61 VRPGVLVLVNDCDWELSGQLDTTLEDKDVIVFISTLHGG 99




Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins; the relevance of such function is however unclear in vivo.
Arabidopsis thaliana (taxid: 3702)
>sp|A0MDQ1|URM11_ARATH Ubiquitin-related modifier 1 homolog 1 OS=Arabidopsis thaliana GN=URM1-1 PE=3 SV=2 Back     alignment and function description
>sp|Q0D6M1|URM1_ORYSJ Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. japonica GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q7GBC8|URM1_ORYSI Ubiquitin-related modifier 1 homolog OS=Oryza sativa subsp. indica GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|B6SXH2|URM1_MAIZE Ubiquitin-related modifier 1 homolog OS=Zea mays GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZJU4|URM1_CHICK Ubiquitin-related modifier 1 homolog OS=Gallus gallus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|A9YUB5|URM1_CAPHI Ubiquitin-related modifier 1 homolog OS=Capra hircus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q148F0|URM1_BOVIN Ubiquitin-related modifier 1 homolog OS=Bos taurus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 homolog OS=Homo sapiens GN=URM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9D2P4|URM1_MOUSE Ubiquitin-related modifier 1 homolog OS=Mus musculus GN=Urm1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
25554142699 Protein C9orf74, putative [Ricinus commu 1.0 1.0 0.878 2e-43
22545387199 PREDICTED: ubiquitin-related modifier 1 1.0 1.0 0.878 2e-42
44945449899 PREDICTED: ubiquitin-related modifier 1 1.0 1.0 0.868 5e-42
35172551199 uncharacterized protein LOC100306072 [Gl 1.0 1.0 0.838 8e-41
35650524299 PREDICTED: ubiquitin-related modifier 1 1.0 1.0 0.828 1e-40
38850028699 unknown [Lotus japonicus] gi|388506328|g 1.0 1.0 0.838 5e-40
18651126999 ubiquitin-related modifier 1-2 [Arabidop 1.0 1.0 0.828 1e-39
388492868101 unknown [Medicago truncatula] 1.0 0.980 0.831 1e-38
147851956105 hypothetical protein VITISV_018251 [Viti 0.939 0.885 0.849 3e-38
449472681101 PREDICTED: ubiquitin-related modifier 1 1.0 0.980 0.811 4e-38
>gi|255541426|ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis] gi|223548957|gb|EEF50446.1| Protein C9orf74, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  179 bits (453), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 87/99 (87%), Positives = 93/99 (93%)

Query: 1  MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
          MQLTLEFGGGLELLCDSVK+HN++V P  G++KL MKDLL+WV  NLIKERPEMFMKGDS
Sbjct: 1  MQLTLEFGGGLELLCDSVKIHNINVDPKNGADKLTMKDLLAWVRNNLIKERPEMFMKGDS 60

Query: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
          VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
Sbjct: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225453871|ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homolog 2 isoform 1 [Vitis vinifera] gi|296089135|emb|CBI38838.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454498|ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351725511|ref|NP_001237095.1| uncharacterized protein LOC100306072 [Glycine max] gi|255627445|gb|ACU14067.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356505242|ref|XP_003521401.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Glycine max] Back     alignment and taxonomy information
>gi|388500286|gb|AFK38209.1| unknown [Lotus japonicus] gi|388506328|gb|AFK41230.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|186511269|ref|NP_001118872.1| ubiquitin-related modifier 1-2 [Arabidopsis thaliana] gi|238692413|sp|B3H7G2.1|URM12_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 2 gi|332646635|gb|AEE80156.1| ubiquitin-related modifier 1-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388492868|gb|AFK34500.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147851956|emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449472681|ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
TAIR|locus:451510329299 AT3G61113 "AT3G61113" [Arabido 0.858 0.858 0.811 2e-33
TAIR|locus:4010713712101 AT2G45695 "AT2G45695" [Arabido 0.858 0.841 0.781 6e-32
ZFIN|ZDB-GENE-091204-300101 urm1 "ubiquitin related modifi 0.828 0.811 0.607 2.9e-23
RGD|1306599101 Urm1 "ubiquitin related modifi 0.828 0.811 0.571 2.6e-22
UNIPROTKB|Q5ZJU4101 URM1 "Ubiquitin-related modifi 0.828 0.811 0.571 4.3e-22
UNIPROTKB|Q148F0101 URM1 "Ubiquitin-related modifi 0.828 0.811 0.583 9e-22
UNIPROTKB|A9YUB5101 URM1 "Ubiquitin-related modifi 0.828 0.811 0.583 9e-22
UNIPROTKB|E2QUA4101 URM1 "Uncharacterized protein" 0.828 0.811 0.571 1.1e-21
UNIPROTKB|Q9BTM9101 URM1 "Ubiquitin-related modifi 0.828 0.811 0.559 1.1e-21
UNIPROTKB|F1RR84101 URM1 "Uncharacterized protein" 0.828 0.811 0.559 1.1e-21
TAIR|locus:4515103292 AT3G61113 "AT3G61113" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
 Identities = 69/85 (81%), Positives = 76/85 (89%)

Query:    15 CDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDW 74
             CDSVK+H V++     S+ L MKDLLSWV TNLIKERPEMFMKGD+VRPGVLVLVNDCDW
Sbjct:    15 CDSVKIHKVNINLLNDSDILTMKDLLSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDW 74

Query:    75 ELSGQLDTTLEEKDVVVFISTLHGG 99
             ELSGQLDTTLE+KDV+VFISTLHGG
Sbjct:    75 ELSGQLDTTLEDKDVIVFISTLHGG 99




GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0034227 "tRNA thio-modification" evidence=IEA
TAIR|locus:4010713712 AT2G45695 "AT2G45695" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-300 urm1 "ubiquitin related modifier 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306599 Urm1 "ubiquitin related modifier 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJU4 URM1 "Ubiquitin-related modifier 1 homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q148F0 URM1 "Ubiquitin-related modifier 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A9YUB5 URM1 "Ubiquitin-related modifier 1 homolog" [Capra hircus (taxid:9925)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUA4 URM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTM9 URM1 "Ubiquitin-related modifier 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR84 URM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A9YUB5URM1_CAPHINo assigned EC number0.57570.97970.9603N/Ano
P40554URM1_YEASTNo assigned EC number0.34650.96960.9696yesno
Q9BTM9URM1_HUMANNo assigned EC number0.55550.97970.9603yesno
Q75AD1URM1_ASHGONo assigned EC number0.38610.97970.97yesno
Q9D2P4URM1_MOUSENo assigned EC number0.56700.95950.9405yesno
Q5ZJU4URM1_CHICKNo assigned EC number0.58760.95950.9405yesno
Q6FWQ3URM1_CANGANo assigned EC number0.39600.95950.9693yesno
A3GFM6URM1_PICSTNo assigned EC number0.39600.97970.9603yesno
Q7GBC8URM1_ORYSINo assigned EC number0.761.00.99N/Ano
Q54QN0URM1_DICDINo assigned EC number0.48480.96961.0yesno
Q2U9H6URM1_ASPORNo assigned EC number0.45090.98980.8166yesno
B6SXH2URM1_MAIZENo assigned EC number0.76231.00.9801N/Ano
B3H7G2URM12_ARATHNo assigned EC number0.82821.01.0yesno
Q0D6M1URM1_ORYSJNo assigned EC number0.761.00.99yesno
Q7Q6I6URM1_ANOGANo assigned EC number0.41230.94940.8623yesno
B5FVI0URM1_YARLINo assigned EC number0.45540.97970.9797yesno
Q7KU86URM1_DROMENo assigned EC number0.48480.96960.9504yesno
A0MDQ1URM11_ARATHNo assigned EC number0.81181.00.9801nono
A8IC48URM1_CHLRENo assigned EC number0.53530.98980.9898N/Ano
Q6CQU4URM1_KLULANo assigned EC number0.41580.98980.9702yesno
Q148F0URM1_BOVINNo assigned EC number0.57570.97970.9603yesno
Q1HQ10URM1_BOMMONo assigned EC number0.50500.93930.8532N/Ano
B5DQK2URM1_DROPSNo assigned EC number0.48480.96960.9696yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT3G61113
unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; CONTAINS InterPro DOMAIN/s- Ubiquitin related modifier 1 (InterPro-IPR015221), Ubiquitin-related modifier 1 (InterPro-IPR017188), Molybdopterin synthase/thiamin biosynthesis sulphur carrier, beta-grasp (InterPro-IPR016155); BEST Arabidopsis thaliana protein match is- unknown protein (TAIR-AT2G45695.1); Has 242 Blast hits to 242 proteins in 127 species- Archae - 2; Bacteria - 0; Metazoa - 93; Fungi - 74; Plants - 18; Viruses - 0; Other Eukaryotes - [...] (99 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
CNX5
CNX5 (CO-FACTOR FOR NITRATE, REDUCTASE AND XANTHINE DEHYDROGENASE 5); Mo-molybdopterin cofactor [...] (464 aa)
     0.877
ELO3
ELO3 (ELONGATA 3); histone acetyltransferase; Histone acetyltransferase (By similarity). Part o [...] (565 aa)
      0.441

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
pfam0913896 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) 3e-46
cd0176494 cd01764, Urm1, Urm1-like ubuitin domain 4e-36
COG513196 COG5131, URM1, Ubiquitin-like protein [Posttransla 4e-13
>gnl|CDD|220123 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) Back     alignment and domain information
 Score =  143 bits (362), Expect = 3e-46
 Identities = 57/98 (58%), Positives = 74/98 (75%), Gaps = 2/98 (2%)

Query: 2  QLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSV 61
          ++T+EF GGLELL D  K H V +  P  S  + M DL+ ++  NLIKERPE+F++GD+V
Sbjct: 1  KITVEFLGGLELLFDKQKKHKVTL--PIDSGPVNMGDLIDYIKKNLIKERPEVFLEGDTV 58

Query: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
          RPG+LVL+NDCDWEL G+LD  LE+ D + FISTLHGG
Sbjct: 59 RPGILVLINDCDWELLGELDYVLEDGDKITFISTLHGG 96


Urm1 is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like pathway urmylation. Structural comparisons and phylogenetic analysis of the ubiquitin superfamily has indicated that Urm1 has the most conserved structural and sequence features of the common ancestor of the entire superfamily. Length = 96

>gnl|CDD|176360 cd01764, Urm1, Urm1-like ubuitin domain Back     alignment and domain information
>gnl|CDD|227460 COG5131, URM1, Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
cd0176494 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel 100.0
PF0913896 Urm1: Urm1 (Ubiquitin related modifier); InterPro: 99.97
KOG4146101 consensus Ubiquitin-like protein [Posttranslationa 99.94
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 99.94
COG513196 URM1 Ubiquitin-like protein [Posttranslational mod 99.91
PLN0279982 Molybdopterin synthase sulfur carrier subunit 99.87
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 99.87
PRK1113081 moaD molybdopterin synthase small subunit; Provisi 99.86
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 99.85
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 99.83
COG197784 MoaD Molybdopterin converting factor, small subuni 99.79
PRK0694465 sulfur carrier protein ThiS; Provisional 99.27
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 99.24
PRK0836470 sulfur carrier protein ThiS; Provisional 99.19
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 99.12
PRK0643767 hypothetical protein; Provisional 98.94
PRK0648865 sulfur carrier protein ThiS; Validated 98.94
PRK0805366 sulfur carrier protein ThiS; Provisional 98.88
KOG347484 consensus Molybdopterin converting factor, small s 98.88
PF1445181 Ub-Mut7C: Mut7-C ubiquitin 98.85
PRK0177795 hypothetical protein; Validated 98.75
PRK0565966 sulfur carrier protein ThiS; Validated 98.74
COG210468 ThiS Sulfur transfer protein involved in thiamine 98.68
PRK0586365 sulfur carrier protein ThiS; Provisional 98.55
PRK0744070 hypothetical protein; Provisional 98.52
PF0680582 Lambda_tail_I: Bacteriophage lambda tail assembly 98.51
PRK0769667 sulfur carrier protein ThiS; Provisional 98.41
PRK0608384 sulfur carrier protein ThiS; Provisional 98.36
PRK11840 326 bifunctional sulfur carrier protein/thiazole synth 98.17
PF0365884 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR00534 97.47
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 97.05
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 97.04
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 96.83
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 96.83
COG4723 198 Phage-related protein, tail component [Function un 96.67
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 96.38
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote 95.46
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 95.32
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate 95.31
PTZ0004476 ubiquitin; Provisional 95.2
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, 95.07
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 94.75
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 94.61
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 94.03
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 93.97
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 93.9
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma 93.76
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 93.22
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 92.35
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 92.18
TIGR0298859 YaaA_near_RecF S4 domain protein YaaA. This small 91.93
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 91.47
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 91.46
PF1445357 ThiS-like: ThiS-like ubiquitin 91.45
COG250173 S4-like RNA binding protein [Replication, recombin 90.97
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 90.63
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 89.49
PF1183469 DUF3354: Domain of unknown function (DUF3354); Int 88.93
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 88.87
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 88.85
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 87.94
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 87.54
cd0493876 TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma 87.26
COG291499 Uncharacterized protein conserved in bacteria [Fun 86.71
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 86.4
PF1327565 S4_2: S4 domain; PDB: 1P9K_A. 86.12
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 85.43
PRK1150770 ribosome-associated protein; Provisional 84.77
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 84.52
PLN02560 308 enoyl-CoA reductase 82.57
smart0036360 S4 S4 RNA-binding domain. 80.35
cd0166761 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Syn 80.19
>cd01764 Urm1 Urm1-like ubuitin domain Back     alignment and domain information
Probab=100.00  E-value=3.2e-34  Score=186.16  Aligned_cols=94  Identities=53%  Similarity=0.916  Sum_probs=88.3

Q ss_pred             EEEEEcchHhhhcCCeeEEEEEeCCCCCCCcchHHHHHHHHHHhcCcccccccccCCccccceEEEEcCccceecCCccC
Q 034276            3 LTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDT   82 (99)
Q Consensus         3 v~V~f~a~l~~~~g~~~~~~vev~~~~~~~~~tv~dll~~L~~~~~~~~~~l~~~~g~l~~~v~ilvNg~di~~l~g~~t   82 (99)
                      |+|+|+|+|+.++|+++++.+++|.+   +++||++||++|+++||..++++|.++|++||+|+|||||+||++++|++|
T Consensus         1 i~v~f~ggl~~~~~~~~~~~~~~~~~---~~~tV~dll~~L~~~~~~~~~~lf~~~g~lr~~i~VlvN~~di~~l~g~~t   77 (94)
T cd01764           1 IKVEFLGGLELLFGNQKEHHVVLDGE---KPVTVGDLLDYVASNLLEERPDLFIEGGSVRPGIIVLINDTDWELLGEEDY   77 (94)
T ss_pred             CEEEEechHHHHhCCceEEEEeccCC---CCCcHHHHHHHHHHhCchhhhhhEecCCcccCCEEEEECCccccccCCccc
Confidence            68999999999999988777778732   578999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCEEEEEecCCCC
Q 034276           83 TLEEKDVVVFISTLHGG   99 (99)
Q Consensus        83 ~L~dgD~V~i~p~v~GG   99 (99)
                      +|+|||+|+||||+|||
T Consensus        78 ~L~dgD~v~i~P~v~GG   94 (94)
T cd01764          78 ILEDGDHVVFISTLHGG   94 (94)
T ss_pred             CCCCcCEEEEECCCCCC
Confidence            99999999999999998



Urm1 (Ubiquitin-Related Modifier1) The Urm1 fold, like those of two closely related proteins MoaD (molybdopterin synthase) and ThiS (sulfur carrier protein), is similar to that of ubiquitin although there is little or no sequence similarity. The C-terminal glycines of Urm1 are conjugated to an E1-like protein Uba4 as part of a novel conjugation system in yeast. The Urm1 fold is found only in eukaryotes.

>PF09138 Urm1: Urm1 (Ubiquitin related modifier); InterPro: IPR015221 Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway [] Back     alignment and domain information
>KOG4146 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>PRK11130 moaD molybdopterin synthase small subunit; Provisional Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism] Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>KOG3474 consensus Molybdopterin converting factor, small subunit [Energy production and conversion] Back     alignment and domain information
>PF14451 Ub-Mut7C: Mut7-C ubiquitin Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>PF06805 Lambda_tail_I: Bacteriophage lambda tail assembly protein I; InterPro: IPR010654 This family consists of several Bacteriophage lambda tail assembly protein I and related phage and bacterial sequences Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF03658 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR005346 This is a small family of proteins of unknown function Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>COG4723 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>COG2914 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>PF13275 S4_2: S4 domain; PDB: 1P9K_A Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>PRK11507 ribosome-associated protein; Provisional Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>smart00363 S4 S4 RNA-binding domain Back     alignment and domain information
>cd01667 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
1xo3_A101 Solution Structure Of Ubiquitin Like Protein From M 2e-22
1wgk_A114 Solution Structure Of Mouse Hypothetical Protein 29 2e-22
2k9x_A110 Solution Structure Of Urm1 From Trypanosoma Brucei 3e-13
2ax5_A107 Solution Structure Of Urm1 From Saccharomyces Cerev 3e-11
2qjl_A99 Crystal Structure Of Urm1 Length = 99 3e-11
>pdb|1XO3|A Chain A, Solution Structure Of Ubiquitin Like Protein From Mus Musculus Length = 101 Back     alignment and structure

Iteration: 1

Score = 100 bits (249), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 47/84 (55%), Positives = 64/84 (76%), Gaps = 2/84 (2%) Query: 16 DSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWE 75 D VK H V + P E +++LL W+ NL+KERPE+F++GDSVRPG+LVL+ND DWE Sbjct: 20 DGVKKHQVAL--PGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWE 77 Query: 76 LSGQLDTTLEEKDVVVFISTLHGG 99 L G+LD L+++D ++FISTLHGG Sbjct: 78 LLGELDYQLQDQDSILFISTLHGG 101
>pdb|1WGK|A Chain A, Solution Structure Of Mouse Hypothetical Protein 2900073h19rik Length = 114 Back     alignment and structure
>pdb|2K9X|A Chain A, Solution Structure Of Urm1 From Trypanosoma Brucei Length = 110 Back     alignment and structure
>pdb|2AX5|A Chain A, Solution Structure Of Urm1 From Saccharomyces Cerevisiae Length = 107 Back     alignment and structure
>pdb|2QJL|A Chain A, Crystal Structure Of Urm1 Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 2e-38
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 1e-35
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 3e-35
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 2e-09
1v8c_A168 MOAD related protein; riken structural genomics/pr 3e-06
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 3e-05
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 2e-04
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 5e-04
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Length = 114 Back     alignment and structure
 Score =  123 bits (310), Expect = 2e-38
 Identities = 55/99 (55%), Positives = 75/99 (75%), Gaps = 2/99 (2%)

Query: 1   MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
           + + +EFGGG ELL D VK H V +  P   E   +++LL W+  NL+KERPE+F++GDS
Sbjct: 12  LCVKVEFGGGAELLFDGVKKHQVAL--PGQEEPWDIRNLLVWIKKNLLKERPELFIQGDS 69

Query: 61  VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
           VRPG+LVL+ND DWEL G+LD  L+++D ++FISTLHGG
Sbjct: 70  VRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 108


>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Length = 99 Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Length = 110 Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Length = 90 Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Length = 168 Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Length = 93 Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Length = 99 Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 100.0
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 100.0
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 99.97
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 99.96
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 99.94
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 99.94
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 99.93
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 99.93
1v8c_A168 MOAD related protein; riken structural genomics/pr 99.84
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 99.83
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 99.81
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 99.8
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 99.39
2cu3_A64 Unknown function protein; thermus thermophilus HB8 99.35
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 99.3
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 99.24
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 99.12
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 99.09
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 98.74
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 98.65
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 98.49
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 97.73
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 97.19
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 97.07
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 96.9
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 96.84
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 96.59
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 96.55
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 96.52
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 96.46
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 96.41
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 96.34
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 96.2
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 96.18
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 95.84
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 95.73
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 95.7
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 95.46
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 95.43
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 95.36
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 95.27
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 95.2
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 95.2
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 94.91
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 94.79
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 94.67
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 94.62
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 94.54
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 94.32
3v6c_B91 Ubiquitin; structural genomics, structural genomic 94.21
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 94.18
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 93.97
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 93.95
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 93.74
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 93.69
3m62_B106 UV excision repair protein RAD23; armadillo-like r 93.65
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 93.65
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 93.22
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 93.12
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 93.11
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 93.02
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 92.95
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 92.8
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 92.59
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 92.56
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 92.53
1we6_A111 Splicing factor, putative; structural genomics, ub 92.49
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 92.13
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 91.97
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 91.9
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 91.69
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 90.9
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 91.47
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 91.46
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 91.44
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 91.4
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 91.29
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 91.23
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 91.23
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 90.83
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 90.8
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 90.56
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 90.46
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 90.29
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 90.26
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 90.2
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 89.82
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 89.28
2pjh_A80 Protein NPL4, nuclear protein localization protein 89.26
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 88.52
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 88.51
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 87.99
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 87.9
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 87.57
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 87.29
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 87.04
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 86.82
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 86.65
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 86.43
2bb6_A414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 85.62
3u7z_A101 Putative metal binding protein rumgna_00854; the b 85.01
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 84.81
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 84.28
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 83.63
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 83.45
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 83.27
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 83.07
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 83.05
3w1s_C91 Ubiquitin-like protein ATG12; ubiquitin fold, E3-l 82.76
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 81.4
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 81.13
3po8_A100 RV0020C protein, putative uncharacterized protein 81.02
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
Probab=100.00  E-value=5.2e-35  Score=194.66  Aligned_cols=97  Identities=56%  Similarity=1.020  Sum_probs=89.1

Q ss_pred             CeEEEEEcchHhhhcCCeeEEEEEeCCCCCCCcchHHHHHHHHHHhcCcccccccccCCccccceEEEEcCccceecCCc
Q 034276            1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQL   80 (99)
Q Consensus         1 M~v~V~f~a~l~~~~g~~~~~~vev~~~~~~~~~tv~dll~~L~~~~~~~~~~l~~~~g~l~~~v~ilvNg~di~~l~g~   80 (99)
                      |+|+|+|+|+||+++|+++++++++|.  ..+++||++||++|+++||..++++|+++|++||+|+|+|||+||++++|+
T Consensus        12 M~v~V~~~~~Lr~~~g~~~~~~vel~~--~~~~~TV~~Ll~~L~~~~~~~~~~lf~~~g~lr~~i~VlVN~~di~~l~gl   89 (114)
T 1wgk_A           12 LCVKVEFGGGAELLFDGVKKHQVALPG--QEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGEL   89 (114)
T ss_dssp             EEEEEEECTTTGGGTTTCSEEEEEECC--CSSCCBHHHHHHHHTTTTCCSCHHHHCCSSSCCSSEEEEESSSBHHHHCTT
T ss_pred             cEEEEEEchHHHHHhCCceEEEEEeCC--CCCCCCHHHHHHHHHHHccchhHhhCccCCcccCCeEEEECCeeeeccCCc
Confidence            789999999999999987667899882  012369999999999999999999999999999999999999999999999


Q ss_pred             cCccCCCCEEEEEecCCCC
Q 034276           81 DTTLEEKDVVVFISTLHGG   99 (99)
Q Consensus        81 ~t~L~dgD~V~i~p~v~GG   99 (99)
                      +|+|+|||+|+||||+|||
T Consensus        90 dt~L~dGDeV~iip~vaGG  108 (114)
T 1wgk_A           90 DYQLQDQDSILFISTLHGG  108 (114)
T ss_dssp             TCBCCSSEEEEEEECSCCC
T ss_pred             CcCCCCCCEEEEeCCCCCC
Confidence            9999999999999999998



>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 99
d1xo3a_101 d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus 8e-29
d1v8ca187 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal 4e-05
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: MoaD/ThiS
family: C9orf74 homolog
domain: C9orf74 homolog
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 97.7 bits (243), Expect = 8e-29
 Identities = 55/99 (55%), Positives = 75/99 (75%), Gaps = 2/99 (2%)

Query: 1   MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
           + + +EFGGG ELL D VK H V +  P   E   +++LL W+  NL+KERPE+F++GDS
Sbjct: 5   LCVKVEFGGGAELLFDGVKKHQVAL--PGQEEPWDIRNLLVWIKKNLLKERPELFIQGDS 62

Query: 61  VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
           VRPG+LVL+ND DWEL G+LD  L+++D ++FISTLHGG
Sbjct: 63  VRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101


>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 100.0
d1v8ca187 MoaD-related protein, N-terminal domain {Thermus t 99.94
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 99.94
d1fm0d_81 Molybdopterin synthase subunit MoaD {Escherichia c 99.83
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 98.79
d1tygb_65 Thiamin biosynthesis sulfur carrier protein ThiS { 98.05
d1rwsa_68 Hypothetical protein PF1061 {Archaeon Pyrococcus f 97.95
d2cu3a163 Uncharacterised protein TTHA0675 {Thermus thermoph 97.89
d2hj1a177 Hypothetical protein HI0395 {Haemophilus influenza 97.13
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 96.74
d1wxqa276 GTP-binding protein PH0525 {Pyrococcus horikoshii 96.13
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 95.44
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 95.24
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 95.21
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 95.2
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 94.98
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 94.94
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 94.62
d1ryja_70 Hypothetical protein MTH1743 {Archaeon Methanobact 94.56
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 94.53
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 94.43
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 94.24
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 94.21
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 94.21
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 93.92
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 93.86
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 93.59
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 93.38
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 93.15
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 92.82
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 92.59
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.56
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 91.86
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 91.51
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 91.44
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 90.93
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 90.89
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 90.3
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 90.23
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 89.07
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 88.71
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 86.93
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 86.89
d1nyra259 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 86.5
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 86.16
d1c06a_159 Ribosomal protein S4 {Bacillus stearothermophilus 86.0
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 84.3
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 84.14
d2exda172 Hypothetical protein PH0471 {Pyrococcus horikoshii 82.84
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 82.71
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 82.4
d2gy9d1204 Ribosomal protein S4 {Escherichia coli [TaxId: 562 82.28
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 82.25
d2uubd1208 Ribosomal protein S4 {Thermus thermophilus [TaxId: 80.75
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 80.57
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: MoaD/ThiS
family: C9orf74 homolog
domain: C9orf74 homolog
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.4e-36  Score=194.45  Aligned_cols=97  Identities=56%  Similarity=1.020  Sum_probs=91.6

Q ss_pred             CeEEEEEcchHhhhcCCeeEEEEEeCCCCCCCcchHHHHHHHHHHhcCcccccccccCCccccceEEEEcCccceecCCc
Q 034276            1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQL   80 (99)
Q Consensus         1 M~v~V~f~a~l~~~~g~~~~~~vev~~~~~~~~~tv~dll~~L~~~~~~~~~~l~~~~g~l~~~v~ilvNg~di~~l~g~   80 (99)
                      |+|+|+|+|+||.+|+++++++++++.  .+++.||+|||++|+++||..++++|+++|++|++|+|+|||+||++++|+
T Consensus         5 m~V~V~F~g~L~~lf~~~r~~~v~l~~--~~~~~TV~dll~~L~~~~p~~~~~l~~~~~~lr~~v~v~vN~~di~~l~gl   82 (101)
T d1xo3a_           5 LCVKVEFGGGAELLFDGVKKHQVALPG--QEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGEL   82 (101)
T ss_dssp             CEEEEEECSSGGGGGTTCCCEEEECCS--SSCCCCHHHHHHHHHHHHCCSCGGGSCCTTSCCSSEEEEETTEEHHHHTTT
T ss_pred             eEEEEEEechHHHHhCCcceEEEEcCC--CCCCcCHHHHHHHHHHhCCcchhhhhccCcCeeeeEEEEEcCcceeccCCC
Confidence            899999999999999998888888873  225789999999999999999999999999999999999999999999999


Q ss_pred             cCccCCCCEEEEEecCCCC
Q 034276           81 DTTLEEKDVVVFISTLHGG   99 (99)
Q Consensus        81 ~t~L~dgD~V~i~p~v~GG   99 (99)
                      +|+|++||+|+||||||||
T Consensus        83 ~t~l~dgDeV~~~p~v~GG  101 (101)
T d1xo3a_          83 DYQLQDQDSILFISTLHGG  101 (101)
T ss_dssp             SCCCCTTCEEEEEETTCCC
T ss_pred             ccCcCCCCEEEEeCCCCCC
Confidence            9999999999999999999



>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rwsa_ d.15.3.2 (A:) Hypothetical protein PF1061 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2exda1 b.40.12.1 (A:72-143) Hypothetical protein PH0471 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2uubd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure