Citrus Sinensis ID: 034276
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| 255541426 | 99 | Protein C9orf74, putative [Ricinus commu | 1.0 | 1.0 | 0.878 | 2e-43 | |
| 225453871 | 99 | PREDICTED: ubiquitin-related modifier 1 | 1.0 | 1.0 | 0.878 | 2e-42 | |
| 449454498 | 99 | PREDICTED: ubiquitin-related modifier 1 | 1.0 | 1.0 | 0.868 | 5e-42 | |
| 351725511 | 99 | uncharacterized protein LOC100306072 [Gl | 1.0 | 1.0 | 0.838 | 8e-41 | |
| 356505242 | 99 | PREDICTED: ubiquitin-related modifier 1 | 1.0 | 1.0 | 0.828 | 1e-40 | |
| 388500286 | 99 | unknown [Lotus japonicus] gi|388506328|g | 1.0 | 1.0 | 0.838 | 5e-40 | |
| 186511269 | 99 | ubiquitin-related modifier 1-2 [Arabidop | 1.0 | 1.0 | 0.828 | 1e-39 | |
| 388492868 | 101 | unknown [Medicago truncatula] | 1.0 | 0.980 | 0.831 | 1e-38 | |
| 147851956 | 105 | hypothetical protein VITISV_018251 [Viti | 0.939 | 0.885 | 0.849 | 3e-38 | |
| 449472681 | 101 | PREDICTED: ubiquitin-related modifier 1 | 1.0 | 0.980 | 0.811 | 4e-38 |
| >gi|255541426|ref|XP_002511777.1| Protein C9orf74, putative [Ricinus communis] gi|223548957|gb|EEF50446.1| Protein C9orf74, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 179 bits (453), Expect = 2e-43, Method: Compositional matrix adjust.
Identities = 87/99 (87%), Positives = 93/99 (93%)
Query: 1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
MQLTLEFGGGLELLCDSVK+HN++V P G++KL MKDLL+WV NLIKERPEMFMKGDS
Sbjct: 1 MQLTLEFGGGLELLCDSVKIHNINVDPKNGADKLTMKDLLAWVRNNLIKERPEMFMKGDS 60
Query: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG
Sbjct: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225453871|ref|XP_002278537.1| PREDICTED: ubiquitin-related modifier 1 homolog 2 isoform 1 [Vitis vinifera] gi|296089135|emb|CBI38838.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449454498|ref|XP_004144991.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|351725511|ref|NP_001237095.1| uncharacterized protein LOC100306072 [Glycine max] gi|255627445|gb|ACU14067.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356505242|ref|XP_003521401.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388500286|gb|AFK38209.1| unknown [Lotus japonicus] gi|388506328|gb|AFK41230.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|186511269|ref|NP_001118872.1| ubiquitin-related modifier 1-2 [Arabidopsis thaliana] gi|238692413|sp|B3H7G2.1|URM12_ARATH RecName: Full=Ubiquitin-related modifier 1 homolog 2 gi|332646635|gb|AEE80156.1| ubiquitin-related modifier 1-2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388492868|gb|AFK34500.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147851956|emb|CAN82245.1| hypothetical protein VITISV_018251 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449472681|ref|XP_004153667.1| PREDICTED: ubiquitin-related modifier 1 homolog 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| TAIR|locus:4515103292 | 99 | AT3G61113 "AT3G61113" [Arabido | 0.858 | 0.858 | 0.811 | 2e-33 | |
| TAIR|locus:4010713712 | 101 | AT2G45695 "AT2G45695" [Arabido | 0.858 | 0.841 | 0.781 | 6e-32 | |
| ZFIN|ZDB-GENE-091204-300 | 101 | urm1 "ubiquitin related modifi | 0.828 | 0.811 | 0.607 | 2.9e-23 | |
| RGD|1306599 | 101 | Urm1 "ubiquitin related modifi | 0.828 | 0.811 | 0.571 | 2.6e-22 | |
| UNIPROTKB|Q5ZJU4 | 101 | URM1 "Ubiquitin-related modifi | 0.828 | 0.811 | 0.571 | 4.3e-22 | |
| UNIPROTKB|Q148F0 | 101 | URM1 "Ubiquitin-related modifi | 0.828 | 0.811 | 0.583 | 9e-22 | |
| UNIPROTKB|A9YUB5 | 101 | URM1 "Ubiquitin-related modifi | 0.828 | 0.811 | 0.583 | 9e-22 | |
| UNIPROTKB|E2QUA4 | 101 | URM1 "Uncharacterized protein" | 0.828 | 0.811 | 0.571 | 1.1e-21 | |
| UNIPROTKB|Q9BTM9 | 101 | URM1 "Ubiquitin-related modifi | 0.828 | 0.811 | 0.559 | 1.1e-21 | |
| UNIPROTKB|F1RR84 | 101 | URM1 "Uncharacterized protein" | 0.828 | 0.811 | 0.559 | 1.1e-21 |
| TAIR|locus:4515103292 AT3G61113 "AT3G61113" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
Identities = 69/85 (81%), Positives = 76/85 (89%)
Query: 15 CDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDW 74
CDSVK+H V++ S+ L MKDLLSWV TNLIKERPEMFMKGD+VRPGVLVLVNDCDW
Sbjct: 15 CDSVKIHKVNINLLNDSDILTMKDLLSWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDW 74
Query: 75 ELSGQLDTTLEEKDVVVFISTLHGG 99
ELSGQLDTTLE+KDV+VFISTLHGG
Sbjct: 75 ELSGQLDTTLEDKDVIVFISTLHGG 99
|
|
| TAIR|locus:4010713712 AT2G45695 "AT2G45695" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091204-300 urm1 "ubiquitin related modifier 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1306599 Urm1 "ubiquitin related modifier 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZJU4 URM1 "Ubiquitin-related modifier 1 homolog" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q148F0 URM1 "Ubiquitin-related modifier 1 homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A9YUB5 URM1 "Ubiquitin-related modifier 1 homolog" [Capra hircus (taxid:9925)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUA4 URM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BTM9 URM1 "Ubiquitin-related modifier 1 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RR84 URM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT3G61113 | unknown protein; FUNCTIONS IN- molecular_function unknown; INVOLVED IN- biological_process unknown; LOCATED IN- cellular_component unknown; CONTAINS InterPro DOMAIN/s- Ubiquitin related modifier 1 (InterPro-IPR015221), Ubiquitin-related modifier 1 (InterPro-IPR017188), Molybdopterin synthase/thiamin biosynthesis sulphur carrier, beta-grasp (InterPro-IPR016155); BEST Arabidopsis thaliana protein match is- unknown protein (TAIR-AT2G45695.1); Has 242 Blast hits to 242 proteins in 127 species- Archae - 2; Bacteria - 0; Metazoa - 93; Fungi - 74; Plants - 18; Viruses - 0; Other Eukaryotes - [...] (99 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| CNX5 | • | • | • | 0.877 | |||||||
| ELO3 | • | • | 0.441 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| pfam09138 | 96 | pfam09138, Urm1, Urm1 (Ubiquitin related modifier) | 3e-46 | |
| cd01764 | 94 | cd01764, Urm1, Urm1-like ubuitin domain | 4e-36 | |
| COG5131 | 96 | COG5131, URM1, Ubiquitin-like protein [Posttransla | 4e-13 |
| >gnl|CDD|220123 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) | Back alignment and domain information |
|---|
Score = 143 bits (362), Expect = 3e-46
Identities = 57/98 (58%), Positives = 74/98 (75%), Gaps = 2/98 (2%)
Query: 2 QLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSV 61
++T+EF GGLELL D K H V + P S + M DL+ ++ NLIKERPE+F++GD+V
Sbjct: 1 KITVEFLGGLELLFDKQKKHKVTL--PIDSGPVNMGDLIDYIKKNLIKERPEVFLEGDTV 58
Query: 62 RPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
RPG+LVL+NDCDWEL G+LD LE+ D + FISTLHGG
Sbjct: 59 RPGILVLINDCDWELLGELDYVLEDGDKITFISTLHGG 96
|
Urm1 is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like pathway urmylation. Structural comparisons and phylogenetic analysis of the ubiquitin superfamily has indicated that Urm1 has the most conserved structural and sequence features of the common ancestor of the entire superfamily. Length = 96 |
| >gnl|CDD|176360 cd01764, Urm1, Urm1-like ubuitin domain | Back alignment and domain information |
|---|
| >gnl|CDD|227460 COG5131, URM1, Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| cd01764 | 94 | Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel | 100.0 | |
| PF09138 | 96 | Urm1: Urm1 (Ubiquitin related modifier); InterPro: | 99.97 | |
| KOG4146 | 101 | consensus Ubiquitin-like protein [Posttranslationa | 99.94 | |
| TIGR01687 | 88 | moaD_arch MoaD family protein, archaeal. Members o | 99.94 | |
| COG5131 | 96 | URM1 Ubiquitin-like protein [Posttranslational mod | 99.91 | |
| PLN02799 | 82 | Molybdopterin synthase sulfur carrier subunit | 99.87 | |
| cd00754 | 80 | MoaD Ubiquitin domain of MoaD-like proteins. MoaD | 99.87 | |
| PRK11130 | 81 | moaD molybdopterin synthase small subunit; Provisi | 99.86 | |
| TIGR01682 | 80 | moaD molybdopterin converting factor, subunit 1, n | 99.85 | |
| PF02597 | 77 | ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam | 99.83 | |
| COG1977 | 84 | MoaD Molybdopterin converting factor, small subuni | 99.79 | |
| PRK06944 | 65 | sulfur carrier protein ThiS; Provisional | 99.27 | |
| cd00565 | 65 | ThiS ThiaminS ubiquitin-like sulfur carrier protei | 99.24 | |
| PRK08364 | 70 | sulfur carrier protein ThiS; Provisional | 99.19 | |
| TIGR01683 | 64 | thiS thiamine biosynthesis protein ThiS. This mode | 99.12 | |
| PRK06437 | 67 | hypothetical protein; Provisional | 98.94 | |
| PRK06488 | 65 | sulfur carrier protein ThiS; Validated | 98.94 | |
| PRK08053 | 66 | sulfur carrier protein ThiS; Provisional | 98.88 | |
| KOG3474 | 84 | consensus Molybdopterin converting factor, small s | 98.88 | |
| PF14451 | 81 | Ub-Mut7C: Mut7-C ubiquitin | 98.85 | |
| PRK01777 | 95 | hypothetical protein; Validated | 98.75 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 98.74 | |
| COG2104 | 68 | ThiS Sulfur transfer protein involved in thiamine | 98.68 | |
| PRK05863 | 65 | sulfur carrier protein ThiS; Provisional | 98.55 | |
| PRK07440 | 70 | hypothetical protein; Provisional | 98.52 | |
| PF06805 | 82 | Lambda_tail_I: Bacteriophage lambda tail assembly | 98.51 | |
| PRK07696 | 67 | sulfur carrier protein ThiS; Provisional | 98.41 | |
| PRK06083 | 84 | sulfur carrier protein ThiS; Provisional | 98.36 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 98.17 | |
| PF03658 | 84 | Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR00534 | 97.47 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 97.05 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 97.04 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 96.83 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 96.83 | |
| COG4723 | 198 | Phage-related protein, tail component [Function un | 96.67 | |
| PF02824 | 60 | TGS: TGS domain; InterPro: IPR004095 The TGS domai | 96.38 | |
| cd01668 | 60 | TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote | 95.46 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 95.32 | |
| cd01666 | 75 | TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate | 95.31 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 95.2 | |
| cd01616 | 60 | TGS The TGS domain, named after the ThrRS, GTPase, | 95.07 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 94.75 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 94.61 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 94.03 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 93.97 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 93.9 | |
| cd01669 | 76 | TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma | 93.76 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 93.22 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 92.35 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 92.18 | |
| TIGR02988 | 59 | YaaA_near_RecF S4 domain protein YaaA. This small | 91.93 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 91.47 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 91.46 | |
| PF14453 | 57 | ThiS-like: ThiS-like ubiquitin | 91.45 | |
| COG2501 | 73 | S4-like RNA binding protein [Replication, recombin | 90.97 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 90.63 | |
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 89.49 | |
| PF11834 | 69 | DUF3354: Domain of unknown function (DUF3354); Int | 88.93 | |
| PF13085 | 110 | Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; | 88.87 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 88.85 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 87.94 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 87.54 | |
| cd04938 | 76 | TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma | 87.26 | |
| COG2914 | 99 | Uncharacterized protein conserved in bacteria [Fun | 86.71 | |
| PF00498 | 68 | FHA: FHA domain; InterPro: IPR000253 The forkhead- | 86.4 | |
| PF13275 | 65 | S4_2: S4 domain; PDB: 1P9K_A. | 86.12 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 85.43 | |
| PRK11507 | 70 | ribosome-associated protein; Provisional | 84.77 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 84.52 | |
| PLN02560 | 308 | enoyl-CoA reductase | 82.57 | |
| smart00363 | 60 | S4 S4 RNA-binding domain. | 80.35 | |
| cd01667 | 61 | TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Syn | 80.19 |
| >cd01764 Urm1 Urm1-like ubuitin domain | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-34 Score=186.16 Aligned_cols=94 Identities=53% Similarity=0.916 Sum_probs=88.3
Q ss_pred EEEEEcchHhhhcCCeeEEEEEeCCCCCCCcchHHHHHHHHHHhcCcccccccccCCccccceEEEEcCccceecCCccC
Q 034276 3 LTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQLDT 82 (99)
Q Consensus 3 v~V~f~a~l~~~~g~~~~~~vev~~~~~~~~~tv~dll~~L~~~~~~~~~~l~~~~g~l~~~v~ilvNg~di~~l~g~~t 82 (99)
|+|+|+|+|+.++|+++++.+++|.+ +++||++||++|+++||..++++|.++|++||+|+|||||+||++++|++|
T Consensus 1 i~v~f~ggl~~~~~~~~~~~~~~~~~---~~~tV~dll~~L~~~~~~~~~~lf~~~g~lr~~i~VlvN~~di~~l~g~~t 77 (94)
T cd01764 1 IKVEFLGGLELLFGNQKEHHVVLDGE---KPVTVGDLLDYVASNLLEERPDLFIEGGSVRPGIIVLINDTDWELLGEEDY 77 (94)
T ss_pred CEEEEechHHHHhCCceEEEEeccCC---CCCcHHHHHHHHHHhCchhhhhhEecCCcccCCEEEEECCccccccCCccc
Confidence 68999999999999988777778732 578999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCEEEEEecCCCC
Q 034276 83 TLEEKDVVVFISTLHGG 99 (99)
Q Consensus 83 ~L~dgD~V~i~p~v~GG 99 (99)
+|+|||+|+||||+|||
T Consensus 78 ~L~dgD~v~i~P~v~GG 94 (94)
T cd01764 78 ILEDGDHVVFISTLHGG 94 (94)
T ss_pred CCCCcCEEEEECCCCCC
Confidence 99999999999999998
|
Urm1 (Ubiquitin-Related Modifier1) The Urm1 fold, like those of two closely related proteins MoaD (molybdopterin synthase) and ThiS (sulfur carrier protein), is similar to that of ubiquitin although there is little or no sequence similarity. The C-terminal glycines of Urm1 are conjugated to an E1-like protein Uba4 as part of a novel conjugation system in yeast. The Urm1 fold is found only in eukaryotes. |
| >PF09138 Urm1: Urm1 (Ubiquitin related modifier); InterPro: IPR015221 Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway [] | Back alignment and domain information |
|---|
| >KOG4146 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01687 moaD_arch MoaD family protein, archaeal | Back alignment and domain information |
|---|
| >COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02799 Molybdopterin synthase sulfur carrier subunit | Back alignment and domain information |
|---|
| >cd00754 MoaD Ubiquitin domain of MoaD-like proteins | Back alignment and domain information |
|---|
| >PRK11130 moaD molybdopterin synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal | Back alignment and domain information |
|---|
| >PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer | Back alignment and domain information |
|---|
| >COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06944 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein | Back alignment and domain information |
|---|
| >PRK08364 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >TIGR01683 thiS thiamine biosynthesis protein ThiS | Back alignment and domain information |
|---|
| >PRK06437 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06488 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >PRK08053 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >KOG3474 consensus Molybdopterin converting factor, small subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF14451 Ub-Mut7C: Mut7-C ubiquitin | Back alignment and domain information |
|---|
| >PRK01777 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05863 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK07440 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06805 Lambda_tail_I: Bacteriophage lambda tail assembly protein I; InterPro: IPR010654 This family consists of several Bacteriophage lambda tail assembly protein I and related phage and bacterial sequences | Back alignment and domain information |
|---|
| >PRK07696 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK06083 sulfur carrier protein ThiS; Provisional | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >PF03658 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR005346 This is a small family of proteins of unknown function | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >COG4723 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] | Back alignment and domain information |
|---|
| >cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >TIGR02988 YaaA_near_RecF S4 domain protein YaaA | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >PF14453 ThiS-like: ThiS-like ubiquitin | Back alignment and domain information |
|---|
| >COG2501 S4-like RNA binding protein [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement | Back alignment and domain information |
|---|
| >PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF | Back alignment and domain information |
|---|
| >COG2914 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins | Back alignment and domain information |
|---|
| >PF13275 S4_2: S4 domain; PDB: 1P9K_A | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >PRK11507 ribosome-associated protein; Provisional | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >smart00363 S4 S4 RNA-binding domain | Back alignment and domain information |
|---|
| >cd01667 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 99 | ||||
| 1xo3_A | 101 | Solution Structure Of Ubiquitin Like Protein From M | 2e-22 | ||
| 1wgk_A | 114 | Solution Structure Of Mouse Hypothetical Protein 29 | 2e-22 | ||
| 2k9x_A | 110 | Solution Structure Of Urm1 From Trypanosoma Brucei | 3e-13 | ||
| 2ax5_A | 107 | Solution Structure Of Urm1 From Saccharomyces Cerev | 3e-11 | ||
| 2qjl_A | 99 | Crystal Structure Of Urm1 Length = 99 | 3e-11 |
| >pdb|1XO3|A Chain A, Solution Structure Of Ubiquitin Like Protein From Mus Musculus Length = 101 | Back alignment and structure |
|
| >pdb|1WGK|A Chain A, Solution Structure Of Mouse Hypothetical Protein 2900073h19rik Length = 114 | Back alignment and structure |
| >pdb|2K9X|A Chain A, Solution Structure Of Urm1 From Trypanosoma Brucei Length = 110 | Back alignment and structure |
| >pdb|2AX5|A Chain A, Solution Structure Of Urm1 From Saccharomyces Cerevisiae Length = 107 | Back alignment and structure |
| >pdb|2QJL|A Chain A, Crystal Structure Of Urm1 Length = 99 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| 1wgk_A | 114 | Riken cDNA 2900073H19 protein; THis domain, ubiqut | 2e-38 | |
| 2qjl_A | 99 | URM1, ubiquitin-related modifier 1; ubiquitin-like | 1e-35 | |
| 2k9x_A | 110 | Tburm1, uncharacterized protein; unknown function; | 3e-35 | |
| 2g1e_A | 90 | Hypothetical protein TA0895; MOAD, molybdopterin, | 2e-09 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 3e-06 | |
| 3dwg_C | 93 | 9.5 kDa culture filtrate antigen CFP10A; sulfur ca | 3e-05 | |
| 2l52_A | 99 | Methanosarcina acetivorans SAMP1 homolog; beta-grA | 2e-04 | |
| 3po0_A | 89 | Small archaeal modifier protein 1; ubiquitin-like | 5e-04 |
| >1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Length = 114 | Back alignment and structure |
|---|
Score = 123 bits (310), Expect = 2e-38
Identities = 55/99 (55%), Positives = 75/99 (75%), Gaps = 2/99 (2%)
Query: 1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
+ + +EFGGG ELL D VK H V + P E +++LL W+ NL+KERPE+F++GDS
Sbjct: 12 LCVKVEFGGGAELLFDGVKKHQVAL--PGQEEPWDIRNLLVWIKKNLLKERPELFIQGDS 69
Query: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
VRPG+LVL+ND DWEL G+LD L+++D ++FISTLHGG
Sbjct: 70 VRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 108
|
| >2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Length = 99 | Back alignment and structure |
|---|
| >2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Length = 110 | Back alignment and structure |
|---|
| >2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Length = 90 | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Length = 168 | Back alignment and structure |
|---|
| >3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Length = 93 | Back alignment and structure |
|---|
| >2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Length = 99 | Back alignment and structure |
|---|
| >3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Length = 89 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| 1wgk_A | 114 | Riken cDNA 2900073H19 protein; THis domain, ubiqut | 100.0 | |
| 2k9x_A | 110 | Tburm1, uncharacterized protein; unknown function; | 100.0 | |
| 2qjl_A | 99 | URM1, ubiquitin-related modifier 1; ubiquitin-like | 99.97 | |
| 3dwg_C | 93 | 9.5 kDa culture filtrate antigen CFP10A; sulfur ca | 99.96 | |
| 3po0_A | 89 | Small archaeal modifier protein 1; ubiquitin-like | 99.94 | |
| 1vjk_A | 98 | Molybdopterin converting factor, subunit 1; struct | 99.94 | |
| 2g1e_A | 90 | Hypothetical protein TA0895; MOAD, molybdopterin, | 99.93 | |
| 2l52_A | 99 | Methanosarcina acetivorans SAMP1 homolog; beta-grA | 99.93 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 99.84 | |
| 1fm0_D | 81 | Molybdopterin convertin factor, subunit 1; molybde | 99.83 | |
| 3rpf_C | 74 | Molybdopterin converting factor, subunit 1 (MOAD); | 99.81 | |
| 2q5w_D | 77 | Molybdopterin converting factor, subunit 1; MOCO, | 99.8 | |
| 1f0z_A | 66 | THis protein; ubiquitin fold, transport protein; N | 99.39 | |
| 2cu3_A | 64 | Unknown function protein; thermus thermophilus HB8 | 99.35 | |
| 1rws_A | 77 | Hypothetical protein PF1061; residual dipolar coup | 99.3 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 99.24 | |
| 1ryj_A | 70 | Unknown; beta/alpha protein, structural genomics, | 99.12 | |
| 2l32_A | 74 | Small archaeal modifier protein 2; protein BIN; NM | 99.09 | |
| 2kl0_A | 73 | Putative thiamin biosynthesis THis; structural gen | 98.74 | |
| 2k5p_A | 78 | THis protein, thiamine-biosynthesis protein; NESG, | 98.65 | |
| 2hj1_A | 97 | Hypothetical protein; structural genomics, PSI, pr | 98.49 | |
| 2kmm_A | 73 | Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy | 97.73 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 97.19 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 97.07 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 96.9 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 96.84 | |
| 3hvz_A | 78 | Uncharacterized protein; alpha-beta protein, struc | 96.59 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 96.55 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 96.52 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 96.46 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 96.41 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 96.34 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 96.2 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 96.18 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 95.84 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 95.73 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 95.7 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 95.46 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 95.43 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 95.36 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 95.27 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 95.2 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 95.2 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 94.91 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 94.79 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 94.67 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 94.62 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 94.54 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 94.32 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 94.21 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 94.18 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 93.97 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 93.95 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 93.74 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 93.69 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 93.65 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 93.65 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 93.22 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 93.12 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 93.11 | |
| 2eki_A | 93 | DRG 1, developmentally-regulated GTP-binding prote | 93.02 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 92.95 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 92.8 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 92.59 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 92.56 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 92.53 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 92.49 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 92.13 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 91.97 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 91.9 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 91.69 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 90.9 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 91.47 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 91.46 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 91.44 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 91.4 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 91.29 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 91.23 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 91.23 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 90.83 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 90.8 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 90.56 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 90.46 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 90.29 | |
| 3va4_A | 132 | Mediator of DNA damage checkpoint protein 1; cell | 90.26 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 90.2 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 89.82 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 89.28 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 89.26 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 88.52 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 88.51 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 87.99 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 87.9 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 87.57 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 87.29 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 87.04 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 86.82 | |
| 1wwt_A | 88 | Threonyl-tRNA synthetase, cytoplasmic; TGS domain, | 86.65 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 86.43 | |
| 2bb6_A | 414 | TCII, TC II, transcobalamin II; alpha_6 - alpha_6 | 85.62 | |
| 3u7z_A | 101 | Putative metal binding protein rumgna_00854; the b | 85.01 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 84.81 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 84.28 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 83.63 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 83.45 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 83.27 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 83.07 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 83.05 | |
| 3w1s_C | 91 | Ubiquitin-like protein ATG12; ubiquitin fold, E3-l | 82.76 | |
| 4h87_A | 130 | Kanadaptin; FHA domain of PF00498, mRNA processing | 81.4 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 81.13 | |
| 3po8_A | 100 | RV0020C protein, putative uncharacterized protein | 81.02 |
| >1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-35 Score=194.66 Aligned_cols=97 Identities=56% Similarity=1.020 Sum_probs=89.1
Q ss_pred CeEEEEEcchHhhhcCCeeEEEEEeCCCCCCCcchHHHHHHHHHHhcCcccccccccCCccccceEEEEcCccceecCCc
Q 034276 1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQL 80 (99)
Q Consensus 1 M~v~V~f~a~l~~~~g~~~~~~vev~~~~~~~~~tv~dll~~L~~~~~~~~~~l~~~~g~l~~~v~ilvNg~di~~l~g~ 80 (99)
|+|+|+|+|+||+++|+++++++++|. ..+++||++||++|+++||..++++|+++|++||+|+|+|||+||++++|+
T Consensus 12 M~v~V~~~~~Lr~~~g~~~~~~vel~~--~~~~~TV~~Ll~~L~~~~~~~~~~lf~~~g~lr~~i~VlVN~~di~~l~gl 89 (114)
T 1wgk_A 12 LCVKVEFGGGAELLFDGVKKHQVALPG--QEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGEL 89 (114)
T ss_dssp EEEEEEECTTTGGGTTTCSEEEEEECC--CSSCCBHHHHHHHHTTTTCCSCHHHHCCSSSCCSSEEEEESSSBHHHHCTT
T ss_pred cEEEEEEchHHHHHhCCceEEEEEeCC--CCCCCCHHHHHHHHHHHccchhHhhCccCCcccCCeEEEECCeeeeccCCc
Confidence 789999999999999987667899882 012369999999999999999999999999999999999999999999999
Q ss_pred cCccCCCCEEEEEecCCCC
Q 034276 81 DTTLEEKDVVVFISTLHGG 99 (99)
Q Consensus 81 ~t~L~dgD~V~i~p~v~GG 99 (99)
+|+|+|||+|+||||+|||
T Consensus 90 dt~L~dGDeV~iip~vaGG 108 (114)
T 1wgk_A 90 DYQLQDQDSILFISTLHGG 108 (114)
T ss_dssp TCBCCSSEEEEEEECSCCC
T ss_pred CcCCCCCCEEEEeCCCCCC
Confidence 9999999999999999998
|
| >2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A | Back alignment and structure |
|---|
| >3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A | Back alignment and structure |
|---|
| >3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A | Back alignment and structure |
|---|
| >1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 | Back alignment and structure |
|---|
| >2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A | Back alignment and structure |
|---|
| >2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 | Back alignment and structure |
|---|
| >1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D | Back alignment and structure |
|---|
| >3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* | Back alignment and structure |
|---|
| >1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 | Back alignment and structure |
|---|
| >2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E | Back alignment and structure |
|---|
| >1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} | Back alignment and structure |
|---|
| >2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A | Back alignment and structure |
|---|
| >2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 | Back alignment and structure |
|---|
| >2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* | Back alignment and structure |
|---|
| >3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 99 | ||||
| d1xo3a_ | 101 | d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus | 8e-29 | |
| d1v8ca1 | 87 | d.15.3.1 (A:1-87) MoaD-related protein, N-terminal | 4e-05 |
| >d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: MoaD/ThiS family: C9orf74 homolog domain: C9orf74 homolog species: Mouse (Mus musculus) [TaxId: 10090]
Score = 97.7 bits (243), Expect = 8e-29
Identities = 55/99 (55%), Positives = 75/99 (75%), Gaps = 2/99 (2%)
Query: 1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDS 60
+ + +EFGGG ELL D VK H V + P E +++LL W+ NL+KERPE+F++GDS
Sbjct: 5 LCVKVEFGGGAELLFDGVKKHQVAL--PGQEEPWDIRNLLVWIKKNLLKERPELFIQGDS 62
Query: 61 VRPGVLVLVNDCDWELSGQLDTTLEEKDVVVFISTLHGG 99
VRPG+LVL+ND DWEL G+LD L+++D ++FISTLHGG
Sbjct: 63 VRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG 101
|
| >d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 87 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| d1xo3a_ | 101 | C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 | 100.0 | |
| d1v8ca1 | 87 | MoaD-related protein, N-terminal domain {Thermus t | 99.94 | |
| d1vjka_ | 88 | Molybdopterin synthase subunit MoaD {Pyrococcus fu | 99.94 | |
| d1fm0d_ | 81 | Molybdopterin synthase subunit MoaD {Escherichia c | 99.83 | |
| d1zud21 | 65 | Thiamin biosynthesis sulfur carrier protein ThiS { | 98.79 | |
| d1tygb_ | 65 | Thiamin biosynthesis sulfur carrier protein ThiS { | 98.05 | |
| d1rwsa_ | 68 | Hypothetical protein PF1061 {Archaeon Pyrococcus f | 97.95 | |
| d2cu3a1 | 63 | Uncharacterised protein TTHA0675 {Thermus thermoph | 97.89 | |
| d2hj1a1 | 77 | Hypothetical protein HI0395 {Haemophilus influenza | 97.13 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 96.74 | |
| d1wxqa2 | 76 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 96.13 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 95.44 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 95.24 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 95.21 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 95.2 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 94.98 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 94.94 | |
| d1kf6b2 | 105 | Fumarate reductase iron-sulfur protein, N-terminal | 94.62 | |
| d1ryja_ | 70 | Hypothetical protein MTH1743 {Archaeon Methanobact | 94.56 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 94.53 | |
| d1nekb2 | 106 | Succinate dehydogenase iron-sulfur protein, N-term | 94.43 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 94.24 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 94.21 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 94.21 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 93.92 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 93.86 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 93.59 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 93.38 | |
| d1tkea1 | 62 | Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi | 93.15 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 92.82 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 92.59 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 92.56 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 91.86 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 91.51 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 91.44 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 90.93 | |
| d2bs2b2 | 106 | Fumarate reductase iron-sulfur protein, N-terminal | 90.89 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 90.3 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 90.23 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 89.07 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 88.71 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 86.93 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 86.89 | |
| d1nyra2 | 59 | Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi | 86.5 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 86.16 | |
| d1c06a_ | 159 | Ribosomal protein S4 {Bacillus stearothermophilus | 86.0 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 84.3 | |
| d1gxca_ | 116 | Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 84.14 | |
| d2exda1 | 72 | Hypothetical protein PH0471 {Pyrococcus horikoshii | 82.84 | |
| d1lgpa_ | 113 | Cell cycle checkpoint protein Chfr {Human (Homo sa | 82.71 | |
| d1g6ga_ | 127 | Phosphotyrosine binding domain of Rad53 {Baker's y | 82.4 | |
| d2gy9d1 | 204 | Ribosomal protein S4 {Escherichia coli [TaxId: 562 | 82.28 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 82.25 | |
| d2uubd1 | 208 | Ribosomal protein S4 {Thermus thermophilus [TaxId: | 80.75 | |
| d2ff4a3 | 99 | Probable regulatory protein EmbR, C-terminal domai | 80.57 |
| >d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: MoaD/ThiS family: C9orf74 homolog domain: C9orf74 homolog species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=3.4e-36 Score=194.45 Aligned_cols=97 Identities=56% Similarity=1.020 Sum_probs=91.6
Q ss_pred CeEEEEEcchHhhhcCCeeEEEEEeCCCCCCCcchHHHHHHHHHHhcCcccccccccCCccccceEEEEcCccceecCCc
Q 034276 1 MQLTLEFGGGLELLCDSVKVHNVDVVPPKGSEKLIMKDLLSWVGTNLIKERPEMFMKGDSVRPGVLVLVNDCDWELSGQL 80 (99)
Q Consensus 1 M~v~V~f~a~l~~~~g~~~~~~vev~~~~~~~~~tv~dll~~L~~~~~~~~~~l~~~~g~l~~~v~ilvNg~di~~l~g~ 80 (99)
|+|+|+|+|+||.+|+++++++++++. .+++.||+|||++|+++||..++++|+++|++|++|+|+|||+||++++|+
T Consensus 5 m~V~V~F~g~L~~lf~~~r~~~v~l~~--~~~~~TV~dll~~L~~~~p~~~~~l~~~~~~lr~~v~v~vN~~di~~l~gl 82 (101)
T d1xo3a_ 5 LCVKVEFGGGAELLFDGVKKHQVALPG--QEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGEL 82 (101)
T ss_dssp CEEEEEECSSGGGGGTTCCCEEEECCS--SSCCCCHHHHHHHHHHHHCCSCGGGSCCTTSCCSSEEEEETTEEHHHHTTT
T ss_pred eEEEEEEechHHHHhCCcceEEEEcCC--CCCCcCHHHHHHHHHHhCCcchhhhhccCcCeeeeEEEEEcCcceeccCCC
Confidence 899999999999999998888888873 225789999999999999999999999999999999999999999999999
Q ss_pred cCccCCCCEEEEEecCCCC
Q 034276 81 DTTLEEKDVVVFISTLHGG 99 (99)
Q Consensus 81 ~t~L~dgD~V~i~p~v~GG 99 (99)
+|+|++||+|+||||||||
T Consensus 83 ~t~l~dgDeV~~~p~v~GG 101 (101)
T d1xo3a_ 83 DYQLQDQDSILFISTLHGG 101 (101)
T ss_dssp SCCCCTTCEEEEEETTCCC
T ss_pred ccCcCCCCEEEEeCCCCCC
Confidence 9999999999999999999
|
| >d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rwsa_ d.15.3.2 (A:) Hypothetical protein PF1061 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2exda1 b.40.12.1 (A:72-143) Hypothetical protein PH0471 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gy9d1 d.66.1.2 (D:2-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2uubd1 d.66.1.2 (D:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|