Citrus Sinensis ID: 034293

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10

MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSDVPFDANTSGKLLCVE

ccHHHHHHHHHHHHHHHHcccHHHHHHccccccccEEcccccccHHHHHHHHHcccccCEEEEEEEEccccccccccEEEEEccCECcccccccccccc

*DPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSDVPFDANTSGKLL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSDVPFDANTSGKLLCVE

Annotation	Function Description	Confidence Level	Reference Protein
Nuclear transport factor 2	Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.	probable	Q9XJ54
Nuclear transport factor 2	Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.	probable	Q6CQX4
Nuclear transport factor 2	Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.	probable	Q75AA5

No confident prediction of EC number!

Template: 1GY7, chain A
Confidence level:very confident
Coverage over the Query: 2-98
View the alignment between query and template
View the model in PyMOL