Citrus Sinensis ID: 034293
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| 255547686 | 123 | nuclear transport factor, putative [Rici | 0.838 | 0.674 | 0.939 | 4e-40 | |
| 297851158 | 122 | hypothetical protein ARALYDRAFT_890252 [ | 0.838 | 0.680 | 0.915 | 8e-39 | |
| 225425388 | 123 | PREDICTED: nuclear transport factor 2 is | 0.838 | 0.674 | 0.927 | 1e-38 | |
| 15223491 | 122 | nuclear transport factor 2A [Arabidopsis | 0.838 | 0.680 | 0.903 | 3e-38 | |
| 224053505 | 123 | predicted protein [Populus trichocarpa] | 0.838 | 0.674 | 0.891 | 2e-37 | |
| 118485528 | 114 | unknown [Populus trichocarpa] | 0.838 | 0.728 | 0.855 | 2e-36 | |
| 224075547 | 123 | predicted protein [Populus trichocarpa] | 0.838 | 0.674 | 0.855 | 3e-36 | |
| 217074584 | 123 | unknown [Medicago truncatula] gi|3885015 | 0.838 | 0.674 | 0.891 | 6e-36 | |
| 358249244 | 123 | uncharacterized protein LOC100777334 [Gl | 0.838 | 0.674 | 0.855 | 8e-36 | |
| 388522467 | 123 | unknown [Lotus japonicus] | 0.838 | 0.674 | 0.867 | 1e-35 |
| >gi|255547686|ref|XP_002514900.1| nuclear transport factor, putative [Ricinus communis] gi|223545951|gb|EEF47454.1| nuclear transport factor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 168 bits (425), Expect = 4e-40, Method: Compositional matrix adjust.
Identities = 78/83 (93%), Positives = 81/83 (97%)
Query: 1 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC 60
MDPD+VAKAFVEHYYTTFDANR GLANLYQE SMLTFEGQKIQG+QN+VAKLTSLPFQQC
Sbjct: 1 MDPDAVAKAFVEHYYTTFDANRAGLANLYQEASMLTFEGQKIQGAQNVVAKLTSLPFQQC 60
Query: 61 QHSITTVDCQPSGPAGGMLVFVS 83
QHSITTVDCQPSGPAGGMLVFVS
Sbjct: 61 QHSITTVDCQPSGPAGGMLVFVS 83
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297851158|ref|XP_002893460.1| hypothetical protein ARALYDRAFT_890252 [Arabidopsis lyrata subsp. lyrata] gi|297339302|gb|EFH69719.1| hypothetical protein ARALYDRAFT_890252 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|225425388|ref|XP_002276841.1| PREDICTED: nuclear transport factor 2 isoform 1 [Vitis vinifera] gi|147821626|emb|CAN70316.1| hypothetical protein VITISV_001831 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15223491|ref|NP_174051.1| nuclear transport factor 2A [Arabidopsis thaliana] gi|9802547|gb|AAF99749.1|AC004557_28 F17L21.10 [Arabidopsis thaliana] gi|14596203|gb|AAK68829.1| similar to nuclear transport factor 2 [Arabidopsis thaliana] gi|18377444|gb|AAL66888.1| similar to nuclear transport factor 2 [Arabidopsis thaliana] gi|332192684|gb|AEE30805.1| nuclear transport factor 2A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224053505|ref|XP_002297847.1| predicted protein [Populus trichocarpa] gi|118483889|gb|ABK93835.1| unknown [Populus trichocarpa] gi|222845105|gb|EEE82652.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118485528|gb|ABK94617.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224075547|ref|XP_002304677.1| predicted protein [Populus trichocarpa] gi|118485124|gb|ABK94425.1| unknown [Populus trichocarpa] gi|222842109|gb|EEE79656.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|217074584|gb|ACJ85652.1| unknown [Medicago truncatula] gi|388501552|gb|AFK38842.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|358249244|ref|NP_001240272.1| uncharacterized protein LOC100777334 [Glycine max] gi|255640724|gb|ACU20646.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388522467|gb|AFK49295.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 99 | ||||||
| TAIR|locus:2015914 | 122 | NTF2A "AT1G27310" [Arabidopsis | 0.838 | 0.680 | 0.903 | 2.4e-37 | |
| TAIR|locus:2010509 | 134 | NTF2B "AT1G27970" [Arabidopsis | 0.838 | 0.619 | 0.843 | 2.2e-34 | |
| ASPGD|ASPL0000071333 | 125 | ntfA [Emericella nidulans (tax | 0.828 | 0.656 | 0.585 | 1e-20 | |
| TAIR|locus:2200066 | 132 | NTL "NTF2-like" [Arabidopsis t | 0.808 | 0.606 | 0.578 | 4e-19 | |
| POMBASE|SPAC15F9.03c | 123 | nxt2 "nuclear transport factor | 0.828 | 0.666 | 0.5 | 1.7e-18 | |
| SGD|S000000811 | 125 | NTF2 "Nuclear envelope protein | 0.888 | 0.704 | 0.483 | 1.7e-18 | |
| DICTYBASE|DDB_G0276425 | 127 | nutf2 "nuclear transport facto | 1.0 | 0.779 | 0.386 | 2e-15 | |
| UNIPROTKB|Q32KP9 | 127 | NUTF2 "Nuclear transport facto | 0.696 | 0.543 | 0.507 | 1.1e-14 | |
| UNIPROTKB|H3BRV9 | 107 | NUTF2 "Nuclear transport facto | 0.696 | 0.644 | 0.507 | 1.1e-14 | |
| UNIPROTKB|J3QS01 | 97 | NUTF2 "Nuclear transport facto | 0.696 | 0.711 | 0.507 | 1.1e-14 |
| TAIR|locus:2015914 NTF2A "AT1G27310" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 401 (146.2 bits), Expect = 2.4e-37, P = 2.4e-37
Identities = 75/83 (90%), Positives = 80/83 (96%)
Query: 1 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC 60
MDPD+VAKAFVEHYY+TFDANR GL +LYQEGSMLTFEGQKIQGSQNIVAKLT LPFQQC
Sbjct: 1 MDPDAVAKAFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTGLPFQQC 60
Query: 61 QHSITTVDCQPSGPAGGMLVFVS 83
+H+ITTVDCQPSGPAGGMLVFVS
Sbjct: 61 KHNITTVDCQPSGPAGGMLVFVS 83
|
|
| TAIR|locus:2010509 NTF2B "AT1G27970" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000071333 ntfA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200066 NTL "NTF2-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC15F9.03c nxt2 "nuclear transport factor Nxt2" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000811 NTF2 "Nuclear envelope protein" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0276425 nutf2 "nuclear transport factor 2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32KP9 NUTF2 "Nuclear transport factor 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BRV9 NUTF2 "Nuclear transport factor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QS01 NUTF2 "Nuclear transport factor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| cd00780 | 119 | cd00780, NTF2, Nuclear transport factor 2 (NTF2) d | 7e-33 | |
| pfam02136 | 116 | pfam02136, NTF2, Nuclear transport factor 2 (NTF2) | 9e-25 | |
| cd00531 | 124 | cd00531, NTF2_like, Nuclear transport factor 2 (NT | 1e-12 |
| >gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
Score = 110 bits (276), Expect = 7e-33
Identities = 44/85 (51%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
Query: 2 DPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQK-IQGSQNIVAKLTSLPFQQC 60
+ VAKAFV+ YY+ FD NR GL LY + SML+ EG K + G IV KL+SLPFQ+
Sbjct: 1 SAEDVAKAFVQQYYSIFDNNREGLHRLYGDTSMLSREGMKQVTGRDAIVEKLSSLPFQKT 60
Query: 61 QHSITTVDCQPSGPAGGMLVFVSDV 85
+H ITTVD QP+ GG++V V+
Sbjct: 61 KHKITTVDSQPTPS-GGVIVMVTGS 84
|
This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119 |
| >gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|238296 cd00531, NTF2_like, Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| KOG2104 | 126 | consensus Nuclear transport factor 2 [Intracellula | 100.0 | |
| cd00780 | 119 | NTF2 Nuclear transport factor 2 (NTF2) domain play | 99.97 | |
| KOG4353 | 139 | consensus RNA export factor NXT1 [RNA processing a | 99.95 | |
| KOG0116 | 419 | consensus RasGAP SH3 binding protein rasputin, con | 99.91 | |
| PF02136 | 118 | NTF2: Nuclear transport factor 2 (NTF2) domain; In | 99.9 | |
| PF10429 | 166 | Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int | 99.74 | |
| cd00531 | 124 | NTF2_like Nuclear transport factor 2 (NTF2-like) s | 98.61 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 97.99 | |
| TIGR02246 | 128 | conserved hypothetical protein. This family consis | 97.44 | |
| PF12680 | 102 | SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 | 97.15 | |
| PF15008 | 262 | DUF4518: Domain of unknown function (DUF4518) | 97.14 | |
| cd00781 | 122 | ketosteroid_isomerase ketosteroid isomerase: Many | 96.8 | |
| PF14534 | 107 | DUF4440: Domain of unknown function (DUF4440); PDB | 96.69 | |
| PF13474 | 121 | SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE | 96.51 | |
| TIGR02096 | 129 | conserved hypothetical protein, steroid delta-isom | 95.41 | |
| PF08332 | 128 | CaMKII_AD: Calcium/calmodulin dependent protein ki | 94.04 | |
| PF13577 | 127 | SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF | 93.87 | |
| PRK09636 | 293 | RNA polymerase sigma factor SigJ; Provisional | 90.2 | |
| TIGR02960 | 324 | SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa | 85.49 | |
| PRK08241 | 339 | RNA polymerase factor sigma-70; Validated | 81.81 | |
| PF07366 | 126 | SnoaL: SnoaL-like polyketide cyclase; InterPro: IP | 81.29 |
| >KOG2104 consensus Nuclear transport factor 2 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-33 Score=180.25 Aligned_cols=96 Identities=56% Similarity=0.829 Sum_probs=92.4
Q ss_pred Ch--HHHHHHHHHHHHHhHccChhhhhccccCCceEEEcCcccccHHHHHHHHhcCCCCceeEEEEEeeeeeeCCCCCEE
Q 034293 2 DP--DSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGML 79 (99)
Q Consensus 2 ~~--~~ig~~Fv~~YY~~l~~~r~~L~~fY~~~S~l~~~g~~~~G~~~I~~~l~~l~~~~~~~~i~s~D~q~~~~~~~il 79 (99)
|+ +.||.+|+++||.+||++|.+|..+|.+.|+|+|||+.+.|.++|.+||.+|||.+++|.|+++|||| +++||||
T Consensus 3 d~~~e~v~~~FvqhYY~~FD~dR~ql~~lY~~~S~LTfEGqq~qG~~~IveKl~sLpFqkiqh~IttvD~QP-t~~g~il 81 (126)
T KOG2104|consen 3 DPVYEAVAKAFVQHYYSLFDNDRSQLGALYIDTSMLTFEGQQIQGKDAIVEKLTSLPFQKIQHSITTVDSQP-TPDGGIL 81 (126)
T ss_pred CccHHHHHHHHHHHHHHHhcCchhHhhhhhcccceeeEcchhhcchHHHHHHHhcCChhhhhceeeeccccc-CCCCcEE
Confidence 56 89999999999999999999999999999999999999999999999999999999999999999999 4899999
Q ss_pred EEEEEEEEeCCCCCccccc
Q 034293 80 VFVSDVPFDANTSGKLLCV 98 (99)
Q Consensus 80 i~V~G~~~~~~~~~~~~~~ 98 (99)
|+|+|.++.++++..+|-|
T Consensus 82 v~V~G~Lk~dEd~~~~FsQ 100 (126)
T KOG2104|consen 82 VMVVGQLKLDEDPILRFSQ 100 (126)
T ss_pred EEEeeeeeeccCCccceee
Confidence 9999999999999988755
|
|
| >cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus | Back alignment and domain information |
|---|
| >KOG4353 consensus RNA export factor NXT1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein | Back alignment and domain information |
|---|
| >PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts | Back alignment and domain information |
|---|
| >cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02246 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A | Back alignment and domain information |
|---|
| >PF15008 DUF4518: Domain of unknown function (DUF4518) | Back alignment and domain information |
|---|
| >cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon | Back alignment and domain information |
|---|
| >PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A | Back alignment and domain information |
|---|
| >PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B | Back alignment and domain information |
|---|
| >TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related | Back alignment and domain information |
|---|
| >PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B | Back alignment and domain information |
|---|
| >PRK09636 RNA polymerase sigma factor SigJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family | Back alignment and domain information |
|---|
| >PRK08241 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >PF07366 SnoaL: SnoaL-like polyketide cyclase; InterPro: IPR009959 This domain is found in SnoaL [] a polyketide cyclase involved in nogalamycin biosynthesis | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 99 | ||||
| 1gy7_A | 125 | N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 | 4e-21 | ||
| 1zo2_A | 129 | Structure Of Nuclear Transport Factor 2 (Ntf2) From | 3e-18 | ||
| 1qma_A | 126 | Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length | 8e-16 | ||
| 1gy5_A | 127 | D92n,D94n Double Point Mutant Of Human Nuclear Tran | 8e-16 | ||
| 1oun_A | 127 | Crystal Structure Of Nuclear Transport Factor 2 (Nt | 8e-16 | ||
| 1jb5_A | 127 | Crystal Structure Of Ntf2 M118e Mutant Length = 127 | 1e-15 | ||
| 1jb2_A | 127 | Crystal Structure Of Ntf2 M84e Mutant Length = 127 | 1e-15 | ||
| 1jb4_A | 127 | Crystal Structure Of Ntf2 M102e Mutant Length = 127 | 1e-15 | ||
| 1ar0_A | 127 | Nuclear Transport Factor 2 (Ntf2) E42k Mutant Lengt | 2e-15 | ||
| 1u5o_A | 127 | Structure Of The D23a Mutant Of The Nuclear Transpo | 6e-15 | ||
| 1ask_A | 127 | Nuclear Transport Factor 2 (Ntf2) H66a Mutant Lengt | 1e-14 | ||
| 1jkg_A | 140 | Structural Basis For The Recognition Of A Nucleopor | 6e-06 | ||
| 3nv0_B | 154 | Crystal Structure And Mutational Analysis Of The Nx | 1e-04 |
| >pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 | Back alignment and structure |
|
| >pdb|1ZO2|A Chain A, Structure Of Nuclear Transport Factor 2 (Ntf2) From Cryptosporidium Parvum Length = 129 | Back alignment and structure |
| >pdb|1QMA|A Chain A, Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length = 126 | Back alignment and structure |
| >pdb|1GY5|A Chain A, D92n,D94n Double Point Mutant Of Human Nuclear Transport Factor 2 (Ntf2) Length = 127 | Back alignment and structure |
| >pdb|1OUN|A Chain A, Crystal Structure Of Nuclear Transport Factor 2 (Ntf2) Length = 127 | Back alignment and structure |
| >pdb|1JB5|A Chain A, Crystal Structure Of Ntf2 M118e Mutant Length = 127 | Back alignment and structure |
| >pdb|1JB2|A Chain A, Crystal Structure Of Ntf2 M84e Mutant Length = 127 | Back alignment and structure |
| >pdb|1JB4|A Chain A, Crystal Structure Of Ntf2 M102e Mutant Length = 127 | Back alignment and structure |
| >pdb|1AR0|A Chain A, Nuclear Transport Factor 2 (Ntf2) E42k Mutant Length = 127 | Back alignment and structure |
| >pdb|1U5O|A Chain A, Structure Of The D23a Mutant Of The Nuclear Transport Carrier Ntf2 Length = 127 | Back alignment and structure |
| >pdb|1ASK|A Chain A, Nuclear Transport Factor 2 (Ntf2) H66a Mutant Length = 127 | Back alignment and structure |
| >pdb|1JKG|A Chain A, Structural Basis For The Recognition Of A Nucleoporin Fg- Repeat By The Ntf2-Like Domain Of Tap-P15 Mrna Nuclear Export Factor Length = 140 | Back alignment and structure |
| >pdb|3NV0|B Chain B, Crystal Structure And Mutational Analysis Of The Nxf2NXT1 Heterodimeric Complex From Caenorhabditis Elegans At 1.84 A Resolution Length = 154 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 99 | |||
| 1gy7_A | 125 | Nuclear transport factor 2; protein transport; 1.6 | 1e-34 | |
| 1gy6_A | 127 | Nuclear transport factor 2; 1.6A {Rattus norvegicu | 4e-31 | |
| 1zo2_A | 129 | NTF2, nuclear transport factor 2; structural genom | 1e-29 | |
| 3ujm_A | 120 | Rasputin; NTF2-like fold, RAS signaling, signaling | 1e-27 | |
| 3q90_A | 140 | RAS GTPase-activating protein-binding protein 1; s | 6e-27 | |
| 1jkg_A | 140 | P15; NTF2-like domain, transport protein; 1.90A {H | 5e-25 | |
| 3nv0_B | 154 | NTF2-related export protein; NTF2-like domain, bet | 2e-24 | |
| 2qiy_A | 154 | UBP3-associated protein BRE5; deubiquitylation, ub | 4e-24 | |
| 1jkg_B | 250 | TAP; NTF2-like domain, transport protein; 1.90A {H | 1e-11 | |
| 1q40_B | 219 | MEX67, mRNA export factor MEX67; NTF2-fold, nuclea | 1e-06 | |
| 1of5_A | 221 | MRNA export factor MEX67; nuclear protein, repeat, | 3e-06 |
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 | Back alignment and structure |
|---|
Score = 114 bits (286), Expect = 1e-34
Identities = 41/83 (49%), Positives = 61/83 (73%)
Query: 1 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQC 60
+D +++A+ F + YY FD +R+ L NLY+ SMLTFE ++QG+++IV KL SLPFQ+
Sbjct: 3 LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKV 62
Query: 61 QHSITTVDCQPSGPAGGMLVFVS 83
QH ITT+D QP+ P G +LV ++
Sbjct: 63 QHRITTLDAQPASPYGDVLVMIT 85
|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 | Back alignment and structure |
|---|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 | Back alignment and structure |
|---|
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 | Back alignment and structure |
|---|
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Length = 250 | Back alignment and structure |
|---|
| >1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Length = 219 | Back alignment and structure |
|---|
| >1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Length = 221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| 1gy7_A | 125 | Nuclear transport factor 2; protein transport; 1.6 | 100.0 | |
| 3ujm_A | 120 | Rasputin; NTF2-like fold, RAS signaling, signaling | 100.0 | |
| 1zo2_A | 129 | NTF2, nuclear transport factor 2; structural genom | 100.0 | |
| 1gy6_A | 127 | Nuclear transport factor 2; 1.6A {Rattus norvegicu | 100.0 | |
| 3q90_A | 140 | RAS GTPase-activating protein-binding protein 1; s | 99.98 | |
| 3nv0_B | 154 | NTF2-related export protein; NTF2-like domain, bet | 99.97 | |
| 2qiy_A | 154 | UBP3-associated protein BRE5; deubiquitylation, ub | 99.97 | |
| 1jkg_A | 140 | P15; NTF2-like domain, transport protein; 1.90A {H | 99.97 | |
| 1q42_A | 201 | MTR2, mRNA transport regulator MTR2; NTF2-fold, nu | 99.91 | |
| 1of5_A | 221 | MRNA export factor MEX67; nuclear protein, repeat, | 99.84 | |
| 1q40_B | 219 | MEX67, mRNA export factor MEX67; NTF2-fold, nuclea | 99.83 | |
| 1jkg_B | 250 | TAP; NTF2-like domain, transport protein; 1.90A {H | 99.83 | |
| 1of5_B | 184 | MTR2, YKL186C, mRNA transport regulator MTR2; nucl | 99.78 | |
| 3nv0_A | 205 | Nuclear RNA export factor 2; NTF2-like domain, bet | 99.61 | |
| 4i4k_A | 143 | Uncharacterized protein SGCJ; structural genomics, | 97.2 | |
| 3dm8_A | 143 | Uncharacterized protein RPA4348; siras, putative i | 97.17 | |
| 2gxf_A | 142 | Hypothetical protein YYBH; alpha-beta protein., st | 97.07 | |
| 3hx8_A | 129 | MLR2180 protein, putative ketosteroid isomerase; s | 97.06 | |
| 3cu3_A | 172 | Domain of unknown function with A cystatin-like F; | 97.03 | |
| 3h3h_A | 122 | Uncharacterized snoal-like protein; structural gen | 96.95 | |
| 3er7_A | 131 | Uncharacterized NTF2-like protein; YP_001812677.1, | 96.8 | |
| 3mg1_A | 323 | OCP, orange carotenoid protein; carotenoid binding | 96.67 | |
| 3i0y_A | 140 | Putative polyketide cyclase; cystatin-like fold, s | 96.57 | |
| 3f7x_A | 151 | Putative polyketide cyclase; structural genomics, | 96.54 | |
| 1ohp_A | 125 | Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 | 96.54 | |
| 4h3u_A | 158 | Hypothetical protein; structural genomics, PSI-bio | 96.41 | |
| 3dxo_A | 121 | Uncharacterized snoal-like protein; putative isome | 96.18 | |
| 3gwr_A | 144 | Putative calcium/calmodulin-dependent protein KIN | 96.16 | |
| 1oh0_A | 131 | Steroid delta-isomerase; ketosteroid isomerase, KS | 96.15 | |
| 3en8_A | 128 | Uncharacterized NTF-2 like protein; YP_553245.1, N | 96.13 | |
| 3fh1_A | 129 | Uncharacterized NTF2-like protein; structural geno | 96.03 | |
| 1nww_A | 149 | Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R | 96.02 | |
| 3gzr_A | 146 | Uncharacterized protein with A NTF2-like fold; str | 95.97 | |
| 3f14_A | 112 | Uncharacterized NTF2-like protein; YP_680363.1, NT | 95.87 | |
| 3rob_A | 139 | Uncharacterized conserved protein; structural geno | 95.84 | |
| 3ff2_A | 117 | Uncharacterized cystatin fold protein (YP_497570. | 95.82 | |
| 1s5a_A | 150 | Hypothetical protein YESE; structural genomics, PS | 95.65 | |
| 3d9r_A | 135 | Ketosteroid isomerase-like protein; YP_049581.1, s | 95.64 | |
| 3mso_A | 143 | Steroid delta-isomerase; structural genomics, join | 95.62 | |
| 2chc_A | 170 | Protein RV3472; hypothetical protein; 1.69A {Mycob | 95.56 | |
| 2gex_A | 152 | SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St | 95.53 | |
| 3jum_A | 185 | Phenazine biosynthesis protein A/B; chirality, dru | 95.53 | |
| 3rga_A | 283 | Epoxide hydrolase; NTF2-like, epoxide-opening cycl | 95.44 | |
| 3bb9_A | 148 | Putative orphan protein; structural genomics, join | 95.41 | |
| 3f9s_A | 146 | Putative polyketide cyclase; structural genomics, | 95.38 | |
| 2gey_A | 158 | ACLR protein; alpha+beta barrel, oxidoreductase; H | 95.31 | |
| 3f40_A | 114 | Uncharacterized NTF2-like protein; YP_677363.1, NT | 95.26 | |
| 3h51_A | 156 | Putative calcium/calmodulin dependent protein KIN | 95.24 | |
| 3b7c_A | 122 | Uncharacterized protein; NTF-2 like protein, struc | 95.2 | |
| 1z1s_A | 163 | Hypothetical protein PA3332; beta barrel, conserve | 95.05 | |
| 2bng_A | 149 | MB2760; epoxide hydrolase, limonene, hydrolase, st | 95.04 | |
| 3ebt_A | 132 | Uncharacterized NTF2-like protein; structural geno | 94.99 | |
| 2k54_A | 123 | Protein ATU0742; protein of unknown function, stru | 94.92 | |
| 2a15_A | 139 | Hypothetical protein RV0760C; beta-alpha-barrel, s | 94.92 | |
| 3fgy_A | 135 | Uncharacterized NTF2-like protein; structural geno | 94.83 | |
| 2rfr_A | 155 | Uncharacterized protein; structural genomics, join | 94.7 | |
| 3ec9_A | 140 | Uncharacterized NTF2-like protein; structural geno | 94.67 | |
| 3f7s_A | 142 | Uncharacterized NTF2-like protein; structural geno | 94.58 | |
| 3b8l_A | 163 | Uncharacterized protein; putative aromatic ring hy | 94.57 | |
| 3dmc_A | 134 | NTF2-like protein; structural genomics, joint cent | 94.49 | |
| 3a76_A | 176 | Gamma-hexachlorocyclohexane dehydrochlorinase; bar | 94.42 | |
| 3rga_A | 283 | Epoxide hydrolase; NTF2-like, epoxide-opening cycl | 94.41 | |
| 3ehc_A | 128 | Snoal-like polyketide cyclase; structural genomics | 94.24 | |
| 2r4i_A | 123 | Uncharacterized protein; NTF2-like protein, struct | 93.96 | |
| 1tuh_A | 156 | BAL32A, hypothetical protein EGC068; unknown funct | 93.86 | |
| 3f8h_A | 150 | Putative polyketide cyclase; structural genomics, | 93.73 | |
| 3gzb_A | 154 | Putative snoal-like polyketide cyclase; YP_0011826 | 93.7 | |
| 2ux0_A | 143 | Calcium-calmodulin dependent protein kinase (CAM I | 93.49 | |
| 3ff0_A | 163 | Phenazine biosynthesis protein PHZB 2; cystatin-li | 93.37 | |
| 3k0z_A | 159 | Putative polyketide cyclase; structural genomics, | 93.21 | |
| 3ejv_A | 179 | Uncharacterized protein with cystatin-like fold; s | 92.99 | |
| 3kkg_A | 146 | Putative snoal-like polyketide cyclase; structural | 92.98 | |
| 3ef8_A | 150 | Putative scyalone dehydratase; YP_496742.1, struct | 92.88 | |
| 3g8z_A | 148 | Protein of unknown function with cystatin-like FO; | 92.83 | |
| 2f99_A | 153 | Aklanonic acid methyl ester cyclase, AKNH; anthrac | 92.5 | |
| 3grd_A | 134 | Uncharacterized NTF2-superfamily protein; NP_97724 | 92.32 | |
| 1sjw_A | 144 | Nogalonic acid methyl ester cyclase; anthracycline | 91.96 | |
| 3g16_A | 156 | Uncharacterized protein with cystatin-like fold; Y | 91.72 | |
| 3f8x_A | 148 | Putative delta-5-3-ketosteroid isomerase; structur | 91.31 | |
| 2owp_A | 129 | Hypothetical protein BXE_B1374; cystatin-like fold | 90.84 | |
| 3cnx_A | 170 | Uncharacterized protein; putative dehydratase, NTF | 90.79 | |
| 3hk4_A | 136 | MLR7391 protein; NTF2-like protein, structural gen | 90.74 | |
| 3g0k_A | 148 | Putative membrane protein; snoal-like polyketide c | 90.44 | |
| 2rgq_A | 144 | Domain of unknown function with A cystatin-like F; | 90.28 | |
| 1tp6_A | 128 | Hypothetical protein PA1314; structural genomics, | 87.19 | |
| 3duk_A | 125 | NTF2-like protein of unknown function; structural | 86.37 | |
| 3lyg_A | 120 | NTF2-like protein of unknown function; structural | 85.77 | |
| 2rcd_A | 129 | Uncharacterized protein; structural genomics, join | 84.9 | |
| 3flj_A | 155 | Uncharacterized protein conserved in bacteria WIT | 84.19 | |
| 3blz_A | 128 | NTF2-like protein of unknown function; structural | 80.82 |
| >1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A | Back alignment and structure |
|---|
Probab=100.00 E-value=6.4e-35 Score=190.62 Aligned_cols=98 Identities=42% Similarity=0.735 Sum_probs=92.9
Q ss_pred CChHHHHHHHHHHHHHhHccChhhhhccccCCceEEEcCcccccHHHHHHHHhcCCCCceeEEEEEeeeeeeCCCCCEEE
Q 034293 1 MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLV 80 (99)
Q Consensus 1 m~~~~ig~~Fv~~YY~~l~~~r~~L~~fY~~~S~l~~~g~~~~G~~~I~~~l~~l~~~~~~~~i~s~D~q~~~~~~~ili 80 (99)
||+++||++||++||+.||++|+.|++||+++|.|+|+|+.+.|+++|.++|.+|||++++|+|.++||||+.+++||+|
T Consensus 3 m~~~~v~~~Fv~~YY~~~d~~r~~L~~~Y~~~S~~s~~g~~~~G~~~I~~~l~~Lp~~~~~h~i~t~D~qp~~~~~gili 82 (125)
T 1gy7_A 3 LDFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLV 82 (125)
T ss_dssp -CHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEETTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESSTTSCEEE
T ss_pred CCHHHHHHHHHHHHHHHHcCCHHHHHHhhCCCcEEEECCcEecCHHHHHHHHHhCCCcceEEEEEEEEEEEecCCCeEEE
Confidence 69999999999999999999999999999999999999999999999999999999999999999999999645689999
Q ss_pred EEEEEEEeCCC-CCccccc
Q 034293 81 FVSDVPFDANT-SGKLLCV 98 (99)
Q Consensus 81 ~V~G~~~~~~~-~~~~~~~ 98 (99)
+|+|.++.+++ +.+.|+|
T Consensus 83 ~V~G~~~~~~~~~~~~F~q 101 (125)
T 1gy7_A 83 MITGDLLIDEEQNPQRFSQ 101 (125)
T ss_dssp EEEEEEEETTCSSCEEEEE
T ss_pred EEEEEEEECCCCCCccEeE
Confidence 99999999988 8888886
|
| >3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A | Back alignment and structure |
|---|
| >3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A | Back alignment and structure |
|---|
| >1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A | Back alignment and structure |
|---|
| >1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A | Back alignment and structure |
|---|
| >1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A | Back alignment and structure |
|---|
| >1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 | Back alignment and structure |
|---|
| >3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 | Back alignment and structure |
|---|
| >3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} | Back alignment and structure |
|---|
| >3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 | Back alignment and structure |
|---|
| >3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* | Back alignment and structure |
|---|
| >3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A | Back alignment and structure |
|---|
| >4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 | Back alignment and structure |
|---|
| >3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} | Back alignment and structure |
|---|
| >1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... | Back alignment and structure |
|---|
| >3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* | Back alignment and structure |
|---|
| >3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 | Back alignment and structure |
|---|
| >3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* | Back alignment and structure |
|---|
| >3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} | Back alignment and structure |
|---|
| >3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >3f9s_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative; 1.76A {Acidithiobacillus ferrooxidans atcc 23} | Back alignment and structure |
|---|
| >2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 | Back alignment and structure |
|---|
| >3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 | Back alignment and structure |
|---|
| >2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A | Back alignment and structure |
|---|
| >3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3a76_A Gamma-hexachlorocyclohexane dehydrochlorinase; barrel fold, lyase, detoxification; HET: SPD; 2.25A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} | Back alignment and structure |
|---|
| >3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 | Back alignment and structure |
|---|
| >1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 | Back alignment and structure |
|---|
| >3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} | Back alignment and structure |
|---|
| >3gzb_A Putative snoal-like polyketide cyclase; YP_001182657.1, STRU genomics, joint center for structural genomics, JCSG; HET: MSE; 1.44A {Shewanella putrefaciens} PDB: 3lza_A* | Back alignment and structure |
|---|
| >2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* | Back alignment and structure |
|---|
| >3ff0_A Phenazine biosynthesis protein PHZB 2; cystatin-like fold, antibiotic biosynthesis, virulence, STRU genomics; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} | Back alignment and structure |
|---|
| >3ejv_A Uncharacterized protein with cystatin-like fold; structural genomics, joint center for ST genomics, JCSG; HET: MSE PGE; 1.40A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3kkg_A Putative snoal-like polyketide cyclase; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2, lyase; HET: MSE PGE; 1.40A {Jannaschia SP} | Back alignment and structure |
|---|
| >3ef8_A Putative scyalone dehydratase; YP_496742.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE PG4; 1.50A {Novosphingobium aromaticivorans DSM12444} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* | Back alignment and structure |
|---|
| >3grd_A Uncharacterized NTF2-superfamily protein; NP_977240.1, NTF2-superfamily protein with unknown function, structural genomics; HET: MSE; 1.25A {Bacillus cereus atcc 10987} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >1sjw_A Nogalonic acid methyl ester cyclase; anthracyclines, nogalamycin, snoal, aldol condensation, LYAS structural genomics; HET: NGV; 1.35A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} | Back alignment and structure |
|---|
| >3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 | Back alignment and structure |
|---|
| >3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3g0k_A Putative membrane protein; snoal-like polyketide cyclase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.30A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2rgq_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.80A {Nostoc punctiforme} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >1tp6_A Hypothetical protein PA1314; structural genomics, alpha-beta sandwich, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.12 | Back alignment and structure |
|---|
| >3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >3lyg_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE GOL; 1.61A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >3flj_A Uncharacterized protein conserved in bacteria WIT cystatin-like fold; YP_168589.1; HET: MSE; 2.00A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3blz_A NTF2-like protein of unknown function; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.75A {Shewanella baltica} SCOP: d.17.4.14 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 99 | ||||
| d1gy7a_ | 121 | d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B | 2e-35 | |
| d1zo2a1 | 117 | d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT | 3e-32 | |
| d1gy6a_ | 125 | d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R | 1e-31 | |
| d1jkga_ | 139 | d.17.4.2 (A:) NTF2-related export protein 1 (p15) | 1e-23 | |
| d2qiya1 | 139 | d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B | 2e-21 | |
| d1of5b_ | 165 | d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker | 6e-14 | |
| d1q40b_ | 205 | d.17.4.2 (B:) NTF2-like domain of mRNA export fact | 3e-07 | |
| d1of5a_ | 221 | d.17.4.2 (A:) NTF2-like domain of mRNA export fact | 3e-06 | |
| d1jkgb_ | 186 | d.17.4.2 (B:) NTF2-like domain of Tip associating | 4e-05 |
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: NTF2-like domain: Nuclear transport factor-2 (NTF2) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 115 bits (289), Expect = 2e-35
Identities = 41/82 (50%), Positives = 60/82 (73%)
Query: 2 DPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQ 61
D +++A+ F + YY FD +R+ L NLY+ SMLTFE ++QG+++IV KL SLPFQ+ Q
Sbjct: 1 DFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQ 60
Query: 62 HSITTVDCQPSGPAGGMLVFVS 83
H ITT+D QP+ P G +LV ++
Sbjct: 61 HRITTLDAQPASPYGDVLVMIT 82
|
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 | Back information, alignment and structure |
|---|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 | Back information, alignment and structure |
|---|
| >d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 | Back information, alignment and structure |
|---|
| >d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Length = 205 | Back information, alignment and structure |
|---|
| >d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 | Back information, alignment and structure |
|---|
| >d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Length = 186 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 99 | |||
| d1gy7a_ | 121 | Nuclear transport factor-2 (NTF2) {Baker's yeast ( | 100.0 | |
| d1zo2a1 | 117 | Nuclear transport factor-2 (NTF2) {Cryptosporidium | 99.98 | |
| d1gy6a_ | 125 | Nuclear transport factor-2 (NTF2) {Rat (Rattus nor | 99.97 | |
| d1jkga_ | 139 | NTF2-related export protein 1 (p15) {Human (Homo s | 99.97 | |
| d2qiya1 | 139 | UBP3-associated protein BRE5 {Baker's yeast (Sacch | 99.95 | |
| d1of5b_ | 165 | mRNA transport regulator MTR2 {Baker's yeast (Sacc | 99.9 | |
| d1q42a_ | 174 | mRNA transport regulator MTR2 {Yeast (Candida albi | 99.58 | |
| d1q40b_ | 205 | NTF2-like domain of mRNA export factor MEX67 {Yeas | 99.52 | |
| d1of5a_ | 221 | NTF2-like domain of mRNA export factor MEX67 {Bake | 99.46 | |
| d1jkgb_ | 186 | NTF2-like domain of Tip associating protein, TAP { | 99.29 | |
| d3en8a1 | 127 | Uncharacterized protein BxeB2092 {Burkholderia xen | 97.83 | |
| d1m98a2 | 142 | Orange carotenoid protein, C-terminal domain {Cyan | 97.79 | |
| d1s5aa_ | 139 | Hypothetical protein YesE {Bacillus subtilis [TaxI | 97.24 | |
| d1ohpa1 | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 97.18 | |
| d1oh0a_ | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 97.16 | |
| d3dm8a1 | 135 | Uncharacterized protein Rpa4348 {Rhodopseudomonas | 97.05 | |
| d1z1sa1 | 129 | Uncharacterized protein PA3332 {Pseudomonas aerugi | 96.94 | |
| d3dmca1 | 133 | Uncharacterized protein Ava2261 {Anabaena variabil | 96.75 | |
| d2bnga1 | 132 | Uncharacterized protein Mb2760 {Mycobacterium tube | 96.74 | |
| d3dxoa1 | 117 | Uncharacterized protein Atu0744 {Agrobacterium tum | 96.43 | |
| d2gxfa1 | 128 | Hypothetical protein YybH {Bacillus subtilis [TaxI | 96.3 | |
| d3bb9a1 | 121 | Uncharacterized protein Sfri1973 {Shewanella frigi | 96.23 | |
| d3ebta1 | 131 | Uncharacterized protein BPSS0132 {Burkholderia pse | 96.22 | |
| d2a15a1 | 132 | Hypothetical protein Rv0760c {Mycobacterium tuberc | 96.19 | |
| d1nwwa_ | 145 | Limonene-1,2-epoxide hydrolase {Rhodococcus erythr | 95.97 | |
| d3cu3a1 | 162 | Uncharacterized protein NpunR1993 {Nostoc punctifo | 95.92 | |
| d3d9ra1 | 132 | Uncharacterized protein ECA1476 {Pectobacterium at | 95.81 | |
| d3b7ca1 | 121 | Uncharacterized protein SO0125 {Shewanella oneiden | 95.29 | |
| d2geya1 | 144 | Putative hydroxylase AclR {Streptomyces galilaeus | 95.07 | |
| d2r4ia1 | 122 | Uncharacterized protein CHU142 {Cytophaga hutchins | 95.01 | |
| d2owpa1 | 128 | Hypothetical protein BxeB1374 {Burkholderia xenovo | 94.72 | |
| d2gexa1 | 138 | Nogalamycin biosynthesis protein SnoL {Streptomyce | 94.37 | |
| d3ec9a1 | 130 | Uncharacterized protein BTHI0051 {Burkholderia tha | 94.06 | |
| d3er7a1 | 118 | Uncharacterized protein Exig0174 {Exiguobacterium | 93.55 | |
| d2rgqa1 | 133 | Uncharacterized protein NpunR3134 {Nostoc punctifo | 93.43 | |
| d3cnxa1 | 153 | Uncharacterized protein SAV4671 {Streptomyces aver | 93.29 | |
| d2f86b1 | 129 | Association domain of calcium/calmodulin-dependent | 93.06 | |
| d2rcda1 | 127 | Uncharacterized protein ECA3500 {Pectobacterium at | 92.87 | |
| d1tuha_ | 131 | Hypothetical protein egc068 from a soil-derived mo | 92.86 | |
| d2k54a1 | 123 | Uncharacterized protein Atu0742 {Agrobacterium tum | 92.77 | |
| d2chca1 | 167 | Uncharacterized protein Rv3472 {Mycobacterium tube | 92.34 | |
| d2ux0a1 | 135 | Association domain of calcium/calmodulin-dependent | 90.88 | |
| d3b8la1 | 144 | Uncharacterized protein Saro3538 {Novosphingobium | 87.69 | |
| d3ejva1 | 159 | Uncharacterized protein Saro2766 {Novosphingobium | 86.79 | |
| d2f99a1 | 140 | Aklanonic acid methyl ester cyclase, AknH {Strepto | 80.31 |
| >d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cystatin-like superfamily: NTF2-like family: NTF2-like domain: Nuclear transport factor-2 (NTF2) species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=2.2e-33 Score=180.75 Aligned_cols=97 Identities=42% Similarity=0.733 Sum_probs=90.9
Q ss_pred ChHHHHHHHHHHHHHhHccChhhhhccccCCceEEEcCcccccHHHHHHHHhcCCCCceeEEEEEeeeeeeCCCCCEEEE
Q 034293 2 DPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVF 81 (99)
Q Consensus 2 ~~~~ig~~Fv~~YY~~l~~~r~~L~~fY~~~S~l~~~g~~~~G~~~I~~~l~~l~~~~~~~~i~s~D~q~~~~~~~ili~ 81 (99)
|+++||++||++||+.|+++|+.|++||.++|.|+|||+++.|.++|.++|++||+++++|+|.++||||++.+++|||+
T Consensus 1 d~~~Ia~~Fv~~YY~~l~~~r~~L~~~Y~~~s~l~~~g~~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Qp~~~~~~ili~ 80 (121)
T d1gy7a_ 1 DFNTLAQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQPASPYGDVLVM 80 (121)
T ss_dssp CHHHHHHHHHHHHHHHHHHHGGGGGGGEEEEEEEEETTEEEESHHHHHHHHHHSCCSCEEEEEEEEEEEESSTTSCEEEE
T ss_pred CHHHHHHHHHHHHHHHHhcCHHHHHHHcCCCcEEEECCeEecCHHHHHHHHHhCCCcccEEEEeeEeeEEccCCCeEEEE
Confidence 68999999999999999999999999999999999999999999999999999999999999999999996567889999
Q ss_pred EEEEEEeCCC-CCccccc
Q 034293 82 VSDVPFDANT-SGKLLCV 98 (99)
Q Consensus 82 V~G~~~~~~~-~~~~~~~ 98 (99)
|+|.++.+++ +++.|+|
T Consensus 81 V~G~~~~~~~~~~~~F~q 98 (121)
T d1gy7a_ 81 ITGDLLIDEEQNPQRFSQ 98 (121)
T ss_dssp EEEEEEETTCSSCEEEEE
T ss_pred EEEEEEECCCCCcceeEE
Confidence 9999999765 4678886
|
| >d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q42a_ d.17.4.2 (A:) mRNA transport regulator MTR2 {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} | Back information, alignment and structure |
|---|
| >d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} | Back information, alignment and structure |
|---|
| >d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} | Back information, alignment and structure |
|---|
| >d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} | Back information, alignment and structure |
|---|
| >d3ec9a1 d.17.4.10 (A:10-139) Uncharacterized protein BTHI0051 {Burkholderia thailandensis [TaxId: 57975]} | Back information, alignment and structure |
|---|
| >d3er7a1 d.17.4.24 (A:5-122) Uncharacterized protein Exig0174 {Exiguobacterium sibiricum 255-15 [TaxId: 262543]} | Back information, alignment and structure |
|---|
| >d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} | Back information, alignment and structure |
|---|
| >d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2chca1 d.17.4.25 (A:1-167) Uncharacterized protein Rv3472 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d3ejva1 d.17.4.28 (A:2-160) Uncharacterized protein Saro2766 {Novosphingobium aromaticivorans [TaxId: 48935]} | Back information, alignment and structure |
|---|
| >d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} | Back information, alignment and structure |
|---|