Citrus Sinensis ID: 034297

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAKQPKDPYLLNPFSGSRILRNFSGRCGSSWRWLQRNLKLITKI
cccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccHHHHHHcHHHHHcc
***KDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGN***************SRILRNFS*RCGSSWRWLQRNLKL****
xxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNERKKLFQMINDLPTIFEVVTGNAKQPKDPYLLNPFSGSRILRNFSGRCGSSWRWLQRNLKLITKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PHD finger protein ALFIN-LIKE 7 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.probableQ8LA16
PHD finger protein ALFIN-LIKE 9 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.probableQ6YTY3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted