Citrus Sinensis ID: 034300


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
ccEEEEEEEcccccEEEEEEcccccHHHHHHHccccccccccccccccccEEEEEEEEEccccccccHHHHHccEEEEEEEEEcccEEEECccccccc
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKE****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferredoxin-1 Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.confidentP0A3C7
Ferredoxin Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.probableP00243
Ferredoxin, root R-B2 Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.probableP14937

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FRR, chain A
Confidence level:very confident
Coverage over the Query: 3-98
View the alignment between query and template
View the model in PyMOL