Citrus Sinensis ID: 034300

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
ccEEEEEEEcccccEEEEEEcccccHHHHHHHccccccccccccccccccEEEEEEEEEccccccccHHHHHccEEEEEEEEEcccEEEEEccccccc
ccEEEEEEEccccEEEEEEEEccccHHHHHHHcccccccccccccccccEEEEEEccEEccccccccHHHHHccEEEHHHcEEcccEEEEcccHHHHc
MAVYKIKligpngeehefeaqeDQYILDAAEeagvdlpyscragacstcagklvsgsvdqsdgsflddnqMEAGYLLTCIsyptsdcviqshkeeelc
mavykikligpngeehefEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
*****IKLI*************DQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVD****SFLDDNQMEAGYLLTCISYPTSDCVI*********
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQ********
*AVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
Q9ZQG8155 Ferredoxin-3, chloroplast yes no 0.979 0.619 0.770 2e-41
P27788152 Ferredoxin-3, chloroplast N/A no 0.989 0.638 0.783 6e-41
P1493798 Ferredoxin, root R-B2 OS= N/A no 0.979 0.979 0.75 5e-39
P1493698 Ferredoxin, root R-B1 OS= N/A no 0.979 0.979 0.75 4e-38
P94044155 Ferredoxin-6, chloroplast N/A no 0.969 0.612 0.705 1e-37
P0024899 Ferredoxin OS=Mastigoclad N/A no 0.989 0.979 0.734 9e-37
P0024397 Ferredoxin OS=Synechocyst N/A no 0.979 0.989 0.721 3e-36
P2732097 Ferredoxin-1 OS=Synechocy N/A no 0.979 0.989 0.721 6e-36
P0A3C799 Ferredoxin-1 OS=Nostoc sp yes no 0.989 0.979 0.714 1e-35
P0A3C899 Ferredoxin-1 OS=Anabaena N/A no 0.989 0.979 0.714 1e-35
>sp|Q9ZQG8|FER3_ARATH Ferredoxin-3, chloroplastic OS=Arabidopsis thaliana GN=FD3 PE=1 SV=1 Back     alignment and function desciption
 Score =  167 bits (422), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 89/96 (92%)

Query: 2   AVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQS 61
           AVYK+KL+GP+G+E EFE Q+DQYILDAAEEAGVDLPYSCRAGACSTCAG++VSG+VDQS
Sbjct: 59  AVYKVKLLGPDGQEDEFEVQDDQYILDAAEEAGVDLPYSCRAGACSTCAGQIVSGNVDQS 118

Query: 62  DGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEEL 97
           DGSFL+D+ +E GY+LTC++YP SDCVI +HKE EL
Sbjct: 119 DGSFLEDSHLEKGYVLTCVAYPQSDCVIHTHKETEL 154
Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
Arabidopsis thaliana (taxid: 3702)
>sp|P27788|FER3_MAIZE Ferredoxin-3, chloroplastic OS=Zea mays GN=FDX3 PE=2 SV=1 Back     alignment and function description
>sp|P14937|FER2_RAPSA Ferredoxin, root R-B2 OS=Raphanus sativus PE=1 SV=1 Back     alignment and function description
>sp|P14936|FER1_RAPSA Ferredoxin, root R-B1 OS=Raphanus sativus PE=1 SV=1 Back     alignment and function description
>sp|P94044|FER6_MAIZE Ferredoxin-6, chloroplastic OS=Zea mays GN=FDX6 PE=2 SV=1 Back     alignment and function description
>sp|P00248|FER_MASLA Ferredoxin OS=Mastigocladus laminosus GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P00243|FER_SYNY4 Ferredoxin OS=Synechocystis sp. (strain PCC 6714) PE=1 SV=2 Back     alignment and function description
>sp|P27320|FER_SYNY3 Ferredoxin-1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P0A3C7|FER1_NOSS1 Ferredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=petF PE=1 SV=2 Back     alignment and function description
>sp|P0A3C8|FER1_ANASO Ferredoxin-1 OS=Anabaena sp. (strain PCC 7119) GN=petF PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
1360725150 non-photosynthetic ferredoxin [Citrus si 1.0 0.653 0.989 4e-50
255565639150 Ferredoxin-3, chloroplast precursor, put 1.0 0.653 0.836 1e-43
359479516154 PREDICTED: ferredoxin-3, chloroplastic-l 0.989 0.629 0.835 9e-42
147819070151 hypothetical protein VITISV_038770 [Viti 0.989 0.642 0.835 1e-41
388497054152 unknown [Lotus japonicus] 0.989 0.638 0.773 2e-40
346473922160 hypothetical protein [Amblyomma maculatu 0.989 0.606 0.783 3e-40
297826083154 hypothetical protein ARALYDRAFT_901657 [ 0.979 0.623 0.770 4e-40
224132362150 predicted protein [Populus trichocarpa] 1.0 0.653 0.785 4e-40
351721230151 uncharacterized protein LOC100499711 [Gl 0.989 0.642 0.773 4e-40
224102833150 predicted protein [Populus trichocarpa] 0.989 0.646 0.814 4e-40
>gi|1360725|emb|CAA87068.1| non-photosynthetic ferredoxin [Citrus sinensis] Back     alignment and taxonomy information
 Score =  201 bits (512), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/98 (98%), Positives = 97/98 (98%)

Query: 1   MAVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQ 60
           MAVYKIKLIGP GEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQ
Sbjct: 53  MAVYKIKLIGPMGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQ 112

Query: 61  SDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC 98
           SDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC
Sbjct: 113 SDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEELC 150

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255565639|ref|XP_002523809.1| Ferredoxin-3, chloroplast precursor, putative [Ricinus communis] gi|223536897|gb|EEF38535.1| Ferredoxin-3, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359479516|ref|XP_002275749.2| PREDICTED: ferredoxin-3, chloroplastic-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147819070|emb|CAN74125.1| hypothetical protein VITISV_038770 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388497054|gb|AFK36593.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|346473922|gb|AEO36805.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|297826083|ref|XP_002880924.1| hypothetical protein ARALYDRAFT_901657 [Arabidopsis lyrata subsp. lyrata] gi|297326763|gb|EFH57183.1| hypothetical protein ARALYDRAFT_901657 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224132362|ref|XP_002328250.1| predicted protein [Populus trichocarpa] gi|222837765|gb|EEE76130.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351721230|ref|NP_001238738.1| uncharacterized protein LOC100499711 [Glycine max] gi|255626003|gb|ACU13346.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224102833|ref|XP_002312819.1| predicted protein [Populus trichocarpa] gi|222849227|gb|EEE86774.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
TAIR|locus:2038593155 FD3 "ferredoxin 3" [Arabidopsi 0.979 0.619 0.770 1.8e-39
UNIPROTKB|P2732097 petF "Ferredoxin-1" [Synechocy 0.979 0.989 0.721 1.2e-35
UNIPROTKB|P0A3C899 petF "Ferredoxin-1" [Nostoc sp 0.989 0.979 0.714 6.5e-35
TAIR|locus:2197349148 FD1 "ferredoxin 1" [Arabidopsi 0.979 0.648 0.701 8.3e-35
UNIPROTKB|P09911149 PETF "Ferredoxin-1, chloroplas 0.979 0.644 0.690 2.2e-34
UNIPROTKB|P8352297 P83522 "Ferredoxin" [Hordeum v 0.969 0.979 0.687 1.1e-32
TAIR|locus:2206061148 FED A [Arabidopsis thaliana (t 0.979 0.648 0.670 1.8e-32
UNIPROTKB|P0A3C998 petF1 "Ferredoxin-1" [Thermosy 0.989 0.989 0.639 6e-32
UNIPROTKB|P8358597 P83585 "Ferredoxin" [Solanum a 0.969 0.979 0.645 1.3e-31
UNIPROTKB|P6816397 P68163 "Ferredoxin" [Datura in 0.969 0.979 0.625 1.1e-30
TAIR|locus:2038593 FD3 "ferredoxin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 421 (153.3 bits), Expect = 1.8e-39, P = 1.8e-39
 Identities = 74/96 (77%), Positives = 89/96 (92%)

Query:     2 AVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQS 61
             AVYK+KL+GP+G+E EFE Q+DQYILDAAEEAGVDLPYSCRAGACSTCAG++VSG+VDQS
Sbjct:    59 AVYKVKLLGPDGQEDEFEVQDDQYILDAAEEAGVDLPYSCRAGACSTCAGQIVSGNVDQS 118

Query:    62 DGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEEL 97
             DGSFL+D+ +E GY+LTC++YP SDCVI +HKE EL
Sbjct:   119 DGSFLEDSHLEKGYVLTCVAYPQSDCVIHTHKETEL 154
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0022900 "electron transport chain" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0009536 "plastid" evidence=IDA
GO:0009688 "abscisic acid biosynthetic process" evidence=RCA
UNIPROTKB|P27320 petF "Ferredoxin-1" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3C8 petF "Ferredoxin-1" [Nostoc sp. PCC 7119 (taxid:1168)] Back     alignment and assigned GO terms
TAIR|locus:2197349 FD1 "ferredoxin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P09911 PETF "Ferredoxin-1, chloroplastic" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
UNIPROTKB|P83522 P83522 "Ferredoxin" [Hordeum vulgare (taxid:4513)] Back     alignment and assigned GO terms
TAIR|locus:2206061 FED A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P0A3C9 petF1 "Ferredoxin-1" [Thermosynechococcus elongatus BP-1 (taxid:197221)] Back     alignment and assigned GO terms
UNIPROTKB|P83585 P83585 "Ferredoxin" [Solanum abutiloides (taxid:45831)] Back     alignment and assigned GO terms
UNIPROTKB|P68163 P68163 "Ferredoxin" [Datura inoxia (taxid:4075)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00243FER_SYNY4No assigned EC number0.72160.97950.9896N/Ano
P14937FER2_RAPSANo assigned EC number0.750.97950.9795N/Ano
P14936FER1_RAPSANo assigned EC number0.750.97950.9795N/Ano
P00246FER_SPIPLNo assigned EC number0.65300.98970.9797N/Ano
P00247FER_CHLFRNo assigned EC number0.70400.98970.9797N/Ano
P00248FER_MASLANo assigned EC number0.73460.98970.9797N/Ano
P0A3D3FER1_SYNP6No assigned EC number0.64280.98970.9797yesno
P0A3D0FER_SYNELNo assigned EC number0.63910.98970.9897N/Ano
P0A3D1FER_THEVLNo assigned EC number0.63910.98970.9897N/Ano
P00226FER_SAMNINo assigned EC number0.66660.96930.9793N/Ano
P00227FER_BRANANo assigned EC number0.67700.96930.9895N/Ano
P00224FER2_SPIOLNo assigned EC number0.66660.96930.9793N/Ano
P00244FER1_APHFLNo assigned EC number0.68040.98970.9897N/Ano
P00245FER_SPIMANo assigned EC number0.68360.98970.9797N/Ano
P15789FER2_CYACANo assigned EC number0.67700.96930.9793N/Ano
P17007FER1_CYAPANo assigned EC number0.65300.98970.9797N/Ano
P0A3D2FER1_SYNE7No assigned EC number0.64280.98970.9797yesno
P00223FER_ARCLANo assigned EC number0.69070.95910.9690N/Ano
P81373FERB_ALOMANo assigned EC number0.66660.97950.9795N/Ano
P81372FERA_ALOMANo assigned EC number0.66660.96930.9793N/Ano
P31965FER1_SYNP2No assigned EC number0.67010.97950.9896yesno
P83522FER_HORVUNo assigned EC number0.68750.96930.9793N/Ano
P27320FER_SYNY3No assigned EC number0.72160.97950.9896N/Ano
P00238FER_SCEQUNo assigned EC number0.65620.96930.9895N/Ano
P27788FER3_MAIZENo assigned EC number0.78350.98970.6381N/Ano
P14938FER3_RAPSANo assigned EC number0.65620.96930.9895N/Ano
P0A3C9FER_THEEBNo assigned EC number0.63910.98970.9897yesno
P0A3C8FER1_ANASONo assigned EC number0.71420.98970.9797N/Ano
P0A3C7FER1_NOSS1No assigned EC number0.71420.98970.9797yesno
P00255FER_SYNLINo assigned EC number0.64940.97950.9896N/Ano
P00254FER1_ANAVTNo assigned EC number0.67340.98970.9797yesno
P00253FER_NOSMUNo assigned EC number0.71420.98970.9797N/Ano
P00252FER1_NOSMUNo assigned EC number0.64580.97950.9696N/Ano
Q9ZQG8FER3_ARATHNo assigned EC number0.77080.97950.6193yesno
Q51577FER1_PLEBONo assigned EC number0.63260.98970.9797N/Ano
P83585FER_SOLABNo assigned EC number0.64580.96930.9793N/Ano
P94044FER6_MAIZENo assigned EC number0.70520.96930.6129N/Ano
O78510FER_GUITHNo assigned EC number0.65970.97950.9896yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
TIGR0200897 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] 4e-53
CHL0013499 CHL00134, petF, ferredoxin; Validated 3e-49
PTZ00038191 PTZ00038, PTZ00038, ferredoxin; Provisional 6e-48
PLN03136148 PLN03136, PLN03136, Ferredoxin; Provisional 3e-44
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 7e-32
PRK07609 339 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucosee 2e-27
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 1e-21
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 2e-20
TIGR02160352 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenas 2e-17
PRK05713 312 PRK05713, PRK05713, hypothetical protein; Provisio 2e-09
PRK11872 340 PRK11872, antC, anthranilate dioxygenase reductase 2e-08
PRK10684332 PRK10684, PRK10684, HCP oxidoreductase, NADH-depen 1e-05
COG1034 693 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone 5e-05
PRK08166 791 PRK08166, PRK08166, NADH dehydrogenase subunit G; 2e-04
PRK1071384 PRK10713, PRK10713, 2Fe-2S ferredoxin YfaE; Provis 0.002
>gnl|CDD|233684 TIGR02008, fdx_plant, ferredoxin [2Fe-2S] Back     alignment and domain information 
 Score =  160 bits (407), Expect = 4e-53
 Identities = 69/96 (71%), Positives = 83/96 (86%)

Query: 2  AVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQS 61
          A YK+ L+ P+G E   E  +DQYILDAAEEAG+DLPYSCRAGACSTCAGK+  G+VDQS
Sbjct: 1  ATYKVTLVNPDGGEETIECPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKVEEGTVDQS 60

Query: 62 DGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEEL 97
          D SFLDD+QMEAGY+LTC++YPTSDC I++HKEE+L
Sbjct: 61 DQSFLDDDQMEAGYVLTCVAYPTSDCTIETHKEEDL 96

This model represents single domain 2Fe-2S (also called plant type) ferredoxins. In general, these occur as a single domain proteins or with a chloroplast transit peptide. Species tend to be photosynthetic, but several forms may occur in one species and individually may not be associated with photocynthesis. Halobacterial forms differ somewhat in architecture; they score between trusted and noise cutoffs. Sequences scoring below the noise cutoff tend to be ferredoxin-related domains of larger proteins. Length = 97
>gnl|CDD|177056 CHL00134, petF, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|240237 PTZ00038, PTZ00038, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|178681 PLN03136, PLN03136, Ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|131215 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>gnl|CDD|235575 PRK05713, PRK05713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183350 PRK11872, antC, anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>gnl|CDD|236735 PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236170 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|182668 PRK10713, PRK10713, 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.97
CHL0013499 petF ferredoxin; Validated 99.97
PLN03136148 Ferredoxin; Provisional 99.96
PTZ00038191 ferredoxin; Provisional 99.95
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.93
PLN02593117 adrenodoxin-like ferredoxin protein 99.91
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.9
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.9
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.9
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.89
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.88
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.88
PTZ00490143 Ferredoxin superfamily; Provisional 99.88
PRK05713 312 hypothetical protein; Provisional 99.87
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.86
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.86
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.86
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.82
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.76
COG3894 614 Uncharacterized metal-binding protein [General fun 99.69
KOG3309159 consensus Ferredoxin [Energy production and conver 99.57
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 99.57
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 99.52
PRK08166 847 NADH dehydrogenase subunit G; Validated 99.38
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 99.27
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 99.25
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.19
PRK09130 687 NADH dehydrogenase subunit G; Validated 99.13
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 99.12
PRK08493 819 NADH dehydrogenase subunit G; Validated 99.02
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 98.99
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 98.98
PRK09129 776 NADH dehydrogenase subunit G; Validated 98.98
PRK08640 249 sdhB succinate dehydrogenase iron-sulfur subunit; 98.93
PRK07860 797 NADH dehydrogenase subunit G; Validated 98.92
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 98.92
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 98.89
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 98.86
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 98.83
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 98.82
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 98.81
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 98.76
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 98.73
PRK12575 235 succinate dehydrogenase iron-sulfur subunit; Provi 98.71
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 98.67
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 98.63
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 98.63
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 98.57
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 98.57
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 98.55
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 98.5
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 98.42
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 98.06
PRK09800 956 putative hypoxanthine oxidase; Provisional 97.99
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 97.92
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 97.7
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 97.66
PLN00192 1344 aldehyde oxidase 97.66
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 97.53
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.9
COG4630 493 XdhA Xanthine dehydrogenase, iron-sulfur cluster a 96.84
KOG3049 288 consensus Succinate dehydrogenase, Fe-S protein su 96.73
KOG0430 1257 consensus Xanthine dehydrogenase [Nucleotide trans 96.25
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 95.43
PLN02906 1319 xanthine dehydrogenase 94.83
smart0045570 RBD Raf-like Ras-binding domain. 94.46
PRK0836470 sulfur carrier protein ThiS; Provisional 94.24
cd0181674 Raf_RBD Ubiquitin domain of Raf serine/threonine k 93.76
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 93.57
PRK0744070 hypothetical protein; Provisional 93.38
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 92.97
PRK0608384 sulfur carrier protein ThiS; Provisional 92.52
PRK0565966 sulfur carrier protein ThiS; Validated 92.46
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 91.88
PRK0177795 hypothetical protein; Validated 91.63
cd0181773 RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS 91.01
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 90.36
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 89.88
PRK0586365 sulfur carrier protein ThiS; Provisional 89.25
cd0181877 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo 88.96
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase 88.81
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 88.33
PF1041840 DHODB_Fe-S_bind: Iron-sulfur cluster binding domai 87.93
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 87.93
COG210468 ThiS Sulfur transfer protein involved in thiamine 86.8
PRK0694465 sulfur carrier protein ThiS; Provisional 86.56
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 85.99
PF0399043 DUF348: Domain of unknown function (DUF348) ; Inte 85.58
PRK0805366 sulfur carrier protein ThiS; Provisional 85.5
PF0365884 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR00534 85.49
PRK05802320 hypothetical protein; Provisional 84.33
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 83.03
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 80.74
PRK0643767 hypothetical protein; Provisional 80.72
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 80.55
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information 
Probab=99.97  E-value=6.7e-31  Score=160.62  Aligned_cols=96  Identities=71%  Similarity=1.255  Sum_probs=89.6

Q ss_pred             eEEEEEEcCCCCEEEEEeCCCchHHHHHHHcCCCccCCCccccccccEEEEeeeeeecCCCCCCChhhhhCCeEEeeeeE
Q 034300            3 VYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISY   82 (98)
Q Consensus         3 ~~~v~i~~~~g~~~~i~~~~g~tlL~a~~~~gi~i~~~C~~G~Cg~C~v~v~~G~~~~~~~~~l~~~~~~~~~~LaCq~~   82 (98)
                      .++|+|+.++|..+++++++|+|||++|+++|+++|++|++|.||+|+++|++|.+.+.+...|+++++++|++|+||++
T Consensus         2 ~~~v~~~~~~~~~~~~~~~~g~tLLda~~~~Gi~i~~~C~~G~Cg~C~v~v~~G~~~~~~~~~l~~~~~~~g~~LaC~~~   81 (97)
T TIGR02008         2 TYKVTLVNPDGGEETIECPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKVEEGTVDQSDQSFLDDDQMEAGYVLTCVAY   81 (97)
T ss_pred             eEEEEEEECCCCEEEEEECCCCcHHHHHHHcCCCCCcCCCCccCCCCceEEEeCcEecCccCCCCHHHHhCCeEEEeeCE
Confidence            57888877888777999999999999999999999999999999999999999999887666789889999999999999


Q ss_pred             ECCCeEEEecCccccC
Q 034300           83 PTSDCVIQSHKEEELC   98 (98)
Q Consensus        83 ~~~d~~i~~~~~~~~~   98 (98)
                      +.+|++|++++++++|
T Consensus        82 ~~~di~v~~~~~~~~~   97 (97)
T TIGR02008        82 PTSDCTIETHKEEDLY   97 (97)
T ss_pred             ECCCeEEEeccccccC
Confidence            9999999999999998

This model represents single domain 2Fe-2S (also called plant type) ferredoxins. In general, these occur as a single domain proteins or with a chloroplast transit peptide. Species tend to be photosynthetic, but several forms may occur in one species and individually may not be associated with photocynthesis. Halobacterial forms differ somewhat in architecture; they score between trusted and noise cutoffs. Sequences scoring below the noise cutoff tend to be ferredoxin-related domains of larger proteins.
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>KOG3309 consensus Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>KOG0430 consensus Xanthine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01816 Raf_RBD Ubiquitin domain of Raf serine/threonine kinases Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PF03990 DUF348: Domain of unknown function (DUF348) ; InterPro: IPR007137 This domain normally occurs as tandem repeats; however it is found as a single copy in the Saccharomyces cerevisiae (Baker's yeast) DNA-binding nuclear protein YCR593 (P25357 from SWISSPROT) Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF03658 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR005346 This is a small family of proteins of unknown function Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
3p63_A96 Structure Of M. Laminosus Ferredoxin With A Shorter 1e-38
1off_A97 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 L 4e-37
1rfk_A98 Crystal Structure Of 2fe2s Ferredoxin From Thermoph 5e-37
1dox_A96 1h And 15n Sequential Assignment, Secondary Structu 2e-36
1fxa_A98 Crystallization And Structure Determination To 2.5- 5e-36
2pvg_C96 Crystal Srtucture Of The Binary Complex Between Fer 8e-36
1qog_A98 Ferredoxin Mutation S47a Length = 98 9e-36
1j7b_A98 Structure Of The Anabaena Ferredoxin Mutant E94k Le 1e-35
1j7c_A98 Structure Of The Anabaena Ferredoxin Mutant E95k Le 1e-35
1qof_A98 Ferredoxin Mutation Q70k Length = 98 1e-35
1qob_A98 Ferredoxin Mutation D62k Length = 98 2e-35
1j7a_A98 Structure Of The Anabaena Ferredoxin D68k Mutant Le 2e-35
1qoa_A98 Ferredoxin Mutation C49s Length = 98 3e-35
1pfd_A96 The Solution Structure Of High Plant Parsley [2fe-2 4e-34
1roe_A97 Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elo 4e-33
3ab5_A97 Crystal Structure Of The 2fe 2s Ferredoxin From Cya 7e-33
4fxc_A98 Tertiary Structure Of [2fe-2s] Ferredoxin From Spir 1e-32
3b2g_A98 Leptolyngbya Boryana Ferredoxin Length = 98 3e-32
1gaq_B98 Crystal Structure Of The Complex Between Ferredoxin 5e-32
3av8_A97 Refined Structure Of Plant-Type [2fe-2s] Ferredoxin 1e-31
1fxi_A96 Structure Of The [2fe-2s] Ferredoxin I From The Blu 5e-31
1awd_A94 Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fu 1e-30
1a70_A97 Spinach Ferredoxin Length = 97 7e-30
1frr_A95 Crystal Structure Of [2fe-2s] Ferredoxin I From Equ 9e-30
1iue_A98 Crystal Structure Analysis Of Ferredoxin From Plasm 3e-26
1wri_A93 Crystal Structure Of Ferredoxin Isoform Ii From E. 8e-25
1frd_A98 Molecular Structure Of The Oxidized, Recombinant, H 3e-17
1e10_A128 [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le 7e-11
1e0z_A128 [2fe-2s]-Ferredoxin From Halobacterium Salinarum Le 8e-11
1doi_A128 2fe-2s Ferredoxin From Haloarcula Marismortui Lengt 9e-11
1krh_A 338 X-Ray Stucture Of Benzoate Dioxygenase Reductase Le 1e-07
3zyy_X 631 Reductive Activator For Corrinoid,Iron-Sulfur Prote 3e-06
1jq4_A98 [2fe-2s] Domain Of Methane Monooxygenase Reductase 4e-06
2pia_A321 Phthalate Dioxygenase Reductase: A Modular Structur 2e-05
>pdb|3P63|A Chain A, Structure Of M. Laminosus Ferredoxin With A Shorter L1,2 Loop Length = 96 Back     alignment and structure 
Iteration: 1

 Score =  154 bits (390), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 85/96 (88%), Gaps = 1/96 (1%)
Query: 2  AVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQS 61
          A YK+ LI P G +   E  +DQYILDAAEEAG+DLPYSCRAGACSTCAGKL+SG+VDQS
Sbjct: 1  ATYKVTLINPTGNK-TIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQS 59
Query: 62 DGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEEL 97
          D SFLDD+Q+EAGY+LTC++YPTSDCVI++HKEEEL
Sbjct: 60 DQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL 95
>pdb|1OFF|A Chain A, 2fe-2s Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 97 Back     alignment and structure
>pdb|1RFK|A Chain A, Crystal Structure Of 2fe2s Ferredoxin From Thermophilic Cyanobacterium Mastigocladus Laminosus Length = 98 Back     alignment and structure
>pdb|1DOX|A Chain A, 1h And 15n Sequential Assignment, Secondary Structure And Tertiary Fold Of [2fe-2s] Ferredoxin From Synechocystis Sp. Pcc 6803 Length = 96 Back     alignment and structure
>pdb|1FXA|A Chain A, Crystallization And Structure Determination To 2.5-Angstroms Resolution Of The Oxidized [2fe-2s] Ferredoxin Isolated From Anabaena 7120 Length = 98 Back     alignment and structure
>pdb|2PVG|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin And Ferredoxin:thioredoxin Reductase Length = 96 Back     alignment and structure
>pdb|1QOG|A Chain A, Ferredoxin Mutation S47a Length = 98 Back     alignment and structure
>pdb|1J7B|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E94k Length = 98 Back     alignment and structure
>pdb|1J7C|A Chain A, Structure Of The Anabaena Ferredoxin Mutant E95k Length = 98 Back     alignment and structure
>pdb|1QOF|A Chain A, Ferredoxin Mutation Q70k Length = 98 Back     alignment and structure
>pdb|1QOB|A Chain A, Ferredoxin Mutation D62k Length = 98 Back     alignment and structure
>pdb|1J7A|A Chain A, Structure Of The Anabaena Ferredoxin D68k Mutant Length = 98 Back     alignment and structure
>pdb|1QOA|A Chain A, Ferredoxin Mutation C49s Length = 98 Back     alignment and structure
>pdb|1PFD|A Chain A, The Solution Structure Of High Plant Parsley [2fe-2s] Ferredoxin, Nmr, 18 Structures Length = 96 Back     alignment and structure
>pdb|1ROE|A Chain A, Nmr Study Of 2fe-2s Ferredoxin Of Synechococcus Elongatus Length = 97 Back     alignment and structure
>pdb|3AB5|A Chain A, Crystal Structure Of The 2fe 2s Ferredoxin From Cyanidioschyzon Merolae Length = 97 Back     alignment and structure
>pdb|4FXC|A Chain A, Tertiary Structure Of [2fe-2s] Ferredoxin From Spirulina Platensis Refined At 2.5 Angstroms Resolution: Structural Comparisons Of Plant-Type Ferredoxins And An Electrostatic Potential Analysis Length = 98 Back     alignment and structure
>pdb|3B2G|A Chain A, Leptolyngbya Boryana Ferredoxin Length = 98 Back     alignment and structure
>pdb|1GAQ|B Chain B, Crystal Structure Of The Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Length = 98 Back     alignment and structure
>pdb|3AV8|A Chain A, Refined Structure Of Plant-Type [2fe-2s] Ferredoxin I From Aphanothece Sacrum At 1.46 A Resolution Length = 97 Back     alignment and structure
>pdb|1FXI|A Chain A, Structure Of The [2fe-2s] Ferredoxin I From The Blue-Green Alga Aphanothece Sacrum At 2.2 Angstroms Resolution Length = 96 Back     alignment and structure
>pdb|1AWD|A Chain A, Ferredoxin [2fe-2s] Oxidized Form From Chlorella Fusca Length = 94 Back     alignment and structure
>pdb|1A70|A Chain A, Spinach Ferredoxin Length = 97 Back     alignment and structure
>pdb|1FRR|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin I From Equisetum Arvense At 1.8 Angstroms Resolution Length = 95 Back     alignment and structure
>pdb|1IUE|A Chain A, Crystal Structure Analysis Of Ferredoxin From Plasmodium Falciparum Length = 98 Back     alignment and structure
>pdb|1WRI|A Chain A, Crystal Structure Of Ferredoxin Isoform Ii From E. Arvense Length = 93 Back     alignment and structure
>pdb|1FRD|A Chain A, Molecular Structure Of The Oxidized, Recombinant, Heterocyst (2fe-2s) Ferredoxin From Anabaena 7120 Determined To 1.7 Angstroms Resolution Length = 98 Back     alignment and structure
>pdb|1E10|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 Back     alignment and structure
>pdb|1E0Z|A Chain A, [2fe-2s]-Ferredoxin From Halobacterium Salinarum Length = 128 Back     alignment and structure
>pdb|1DOI|A Chain A, 2fe-2s Ferredoxin From Haloarcula Marismortui Length = 128 Back     alignment and structure
>pdb|1KRH|A Chain A, X-Ray Stucture Of Benzoate Dioxygenase Reductase Length = 338 Back     alignment and structure
>pdb|3ZYY|X Chain X, Reductive Activator For Corrinoid,Iron-Sulfur Protein Length = 631 Back     alignment and structure
>pdb|1JQ4|A Chain A, [2fe-2s] Domain Of Methane Monooxygenase Reductase From Methylococcus Capsulatus (Bath) Length = 98 Back     alignment and structure
>pdb|2PIA|A Chain A, Phthalate Dioxygenase Reductase: A Modular Structure For Electron Transfer From Pyridine Nucleotides To [2fe-2s] Length = 321 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 1e-52
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 8e-52
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 2e-51
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 3e-51
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 4e-51
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 6e-51
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 4e-48
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 3e-45
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 4e-45
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 4e-26
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 7e-22
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 1e-18
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 9e-07
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 1e-06
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 2e-06
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 2e-06
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 4e-05
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 4e-05
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 4e-05
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 5e-05
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 2e-04
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 2e-04
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 3e-04
4dgw_C231 PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A 8e-04
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Length = 97 Back     alignment and structure
 Score =  158 bits (402), Expect = 1e-52
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 1/96 (1%)

Query: 2  AVYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQS 61
          A YK+ L+ P     EF+  +D YILDAAEE G+DLPYSCRAG+CS+CAGKL +GS++Q 
Sbjct: 1  AAYKVTLVTP-TGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQD 59

Query: 62 DGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEEL 97
          D SFLDD+Q++ G++LTC +YP SD  I++HK+EEL
Sbjct: 60 DQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEEL 95
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Length = 94 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Length = 98 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Length = 95 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Length = 98 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Length = 93 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Length = 98 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Length = 128 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Length = 631 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>4dgw_C PRE-mRNA-splicing factor PRP11; zinc finger; 3.11A {Saccharomyces cerevisiae} Length = 231 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.97
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.97
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.97
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.97
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.97
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.96
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.96
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.95
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.94
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.94
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.94
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.93
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.93
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.93
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.93
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.93
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.92
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.92
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.92
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.92
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.92
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.9
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.89
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.88
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 99.38
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 99.35
1kf6_B 243 Fumarate reductase iron-sulfur protein; respiratio 99.25
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 99.22
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 99.21
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 99.21
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 99.2
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 99.2
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 99.11
2wdq_B 238 Succinate dehydrogenase iron-sulfur subunit; succi 98.94
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 98.81
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 98.56
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 98.5
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 98.44
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 98.43
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 98.33
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 97.86
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 97.68
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 97.06
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.84
3ny5_A96 Serine/threonine-protein kinase B-RAF; NESG, struc 95.52
1c1y_B77 Proto-onkogene serine/threonine protein kinase RAF 94.68
1wxm_A86 A-RAF proto-oncogene serine/threonine-protein kina 94.42
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 93.84
1rrb_A107 RAF-1 RBD, RAF proto-oncogene serine/threonine-pro 92.91
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 92.1
3u7z_A101 Putative metal binding protein rumgna_00854; the b 91.75
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 90.63
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 90.56
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 90.43
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 90.04
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 89.96
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 89.88
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 87.81
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 85.29
3kdv_A184 DDRB, DNA damage response B protein; anti-parallel 85.28
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 84.07
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 84.03
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 83.96
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 83.43
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 83.36
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 82.48
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 82.39
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 81.65
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 81.27
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 81.26
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 80.52
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
Probab=99.97  E-value=3.4e-30  Score=156.50  Aligned_cols=96  Identities=70%  Similarity=1.174  Sum_probs=88.4

Q ss_pred             eEEEEEEcCCCC-EEEEEeCCCchHHHHHHHcCCCccCCCccccccccEEEEeeeeeecCCCCCCChhhhhCCeEEeeee
Q 034300            3 VYKIKLIGPNGE-EHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCIS   81 (98)
Q Consensus         3 ~~~v~i~~~~g~-~~~i~~~~g~tlL~a~~~~gi~i~~~C~~G~Cg~C~v~v~~G~~~~~~~~~l~~~~~~~~~~LaCq~   81 (98)
                      .++|+|..+++. .++|++++|+|||++|+++|+++|++|+.|.||+|+++|++|.+.+.+...|++.+.++|+||+||+
T Consensus         2 ~~~V~~~~~~~~~~~~~~~~~g~tlL~a~~~~gi~i~~~C~~G~Cg~C~v~v~~G~~~~~e~~~L~~~e~~~g~~LaCq~   81 (98)
T 1czp_A            2 TFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVA   81 (98)
T ss_dssp             EEEEEEEETTTTEEEEEEEETTSCHHHHHHHTTCCCCCSSSSSSSSTTEEEEEESCEECTTCCSSCHHHHHTTEEEGGGC
T ss_pred             ceEEEEEeCCCCCcEEEEeCCCCCHHHHHHHcCCCccCCCCCCCCCCCeEEEccCCcCccccccCCHHHhhCCeEEeeeC
Confidence            578998655553 4689999999999999999999999999999999999999999998888899988899999999999


Q ss_pred             EECCCeEEEecCccccC
Q 034300           82 YPTSDCVIQSHKEEELC   98 (98)
Q Consensus        82 ~~~~d~~i~~~~~~~~~   98 (98)
                      ++.+|++|++++++++|
T Consensus        82 ~~~~d~~v~~~~~~~~~   98 (98)
T 1czp_A           82 YPTSDVVIQTHKEEDLY   98 (98)
T ss_dssp             EESSCEEEECCCTTTTC
T ss_pred             EECCCEEEEeccccccC
Confidence            99999999999999987
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 Back     alignment and structure
>1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* Back     alignment and structure
>1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 98
d1czpa_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 1e-32
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 3e-32
d1a70a_97 d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia 3e-31
d1iuea_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite 4e-31
d1wria_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 6e-30
d1awda_94 d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [ 9e-30
d1frra_95 d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense 1e-29
d1doia_128 d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcu 7e-29
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 1e-28
d1frda_98 d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (A 2e-28
d2piaa398 d.15.4.2 (A:224-321) Phthalate dioxygenase reducta 2e-21
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 2e-10
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 6e-09
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 4e-08
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 5e-08
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 6e-07
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 4e-06
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 8e-06
d3c8ya2126 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal 0.003
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]

 Score =  106 bits (267), Expect = 1e-32
 Identities = 69/97 (71%), Positives = 83/97 (85%), Gaps = 1/97 (1%)

Query: 2  AVYKIKLI-GPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQ 60
          A +K+ LI    G +HE E  +D+YILDAAEE G DLP+SCRAGACSTCAGKLVSG+VDQ
Sbjct: 1  ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQ 60

Query: 61 SDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKEEEL 97
          SD SFLDD+Q+EAGY+LTC++YPTSD VIQ+HKEE+L
Sbjct: 61 SDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDL 97
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 97 Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 98 Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 93 Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Length = 94 Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Length = 95 Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 128 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Length = 98 Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 98 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 100.0
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 100.0
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 100.0
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 100.0
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.98
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.97
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.97
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.97
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.97
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.94
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.92
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.91
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.91
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.9
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.9
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.9
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.87
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 99.51
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.2
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 99.18
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 99.18
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 99.11
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 99.07
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.04
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.95
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.95
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 98.85
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 98.64
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 98.63
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 96.32
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 94.89
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 94.77
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 94.63
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 92.34
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 89.38
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 87.79
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 87.73
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 86.17
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 85.73
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 85.69
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 85.2
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 85.02
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 83.42
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 83.39
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 83.19
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 82.67
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 82.25
d2hj1a177 Hypothetical protein HI0395 {Haemophilus influenza 81.97
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 81.28
d1y7ma248 Hypothetical protein YkuD, N-terminal domain {Baci 81.05
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 80.69
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Equisetum arvense [TaxId: 3258]

Probab=100.00  E-value=6.4e-34  Score=171.15  Aligned_cols=95  Identities=65%  Similarity=1.077  Sum_probs=89.5

Q ss_pred             eEEEEEEcCCCCEEEEEeCCCchHHHHHHHcCCCccCCCccccccccEEEEeeeeeecCCCCCCChhhhhCCeEEeeeeE
Q 034300            3 VYKIKLIGPNGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQSDGSFLDDNQMEAGYLLTCISY   82 (98)
Q Consensus         3 ~~~v~i~~~~g~~~~i~~~~g~tlL~a~~~~gi~i~~~C~~G~Cg~C~v~v~~G~~~~~~~~~l~~~~~~~~~~LaCq~~   82 (98)
                      .|+|||..++| .++|++++|+|||++|+++||++|++|+.|.||+|++++++|++.+.+...|++.+.++|+||+||++
T Consensus         1 ~~kVt~~~~~~-~~~~~~~~g~slLda~~~~Gi~ip~~C~~G~CgtC~~~v~~G~v~~~~~~~l~~~e~~~g~~L~C~~~   79 (95)
T d1frra_           1 AYKTVLKTPSG-EFTLDVPEGTTILDAAEEAGYDLPFSCRAGACSSCLGKVVSGSVDESEGSFLDDGQMEEGFVLTCIAI   79 (95)
T ss_dssp             CEEEEEEETTE-EEEEEECTTCCHHHHHHHTTCCCCCSSSSSSSSTTEEEEEESCEECTTCCSCCHHHHHTTEEETTTCE
T ss_pred             CeEEEEECCCC-cEEEEECCCCcHHHHHHHcCCCEEeccCCcEeCCCEEEEecceEcccccccCCHHHHhcCcEEeeeCE
Confidence            37899966776 46899999999999999999999999999999999999999999999888999999999999999999


Q ss_pred             ECCCeEEEecCccccC
Q 034300           83 PTSDCVIQSHKEEELC   98 (98)
Q Consensus        83 ~~~d~~i~~~~~~~~~   98 (98)
                      |.+|++|+++.++++|
T Consensus        80 ~~~d~~ie~~~e~~~~   95 (95)
T d1frra_          80 PESDLVIETHKEEELF   95 (95)
T ss_dssp             ESSCEEEECCCTTTTC
T ss_pred             ECCCEEEEecCccccC
Confidence            9999999999999998
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7ma2 d.7.1.1 (A:1-48) Hypothetical protein YkuD, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure