Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Arabidopsis thaliana (taxid: 3702)
>sp|Q9FUY6|JOIN_SOLLC MADS-box protein JOINTLESS OS=Solanum lycopersicum GN=J PE=1 SV=1
Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Solanum lycopersicum (taxid: 4081)
>sp|O82794|AGL24_ARATH MADS-box protein AGL24 OS=Arabidopsis thaliana GN=AGL24 PE=1 SV=1
Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering.
Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro.
Arabidopsis thaliana (taxid: 3702)
>sp|A2RVQ5|AGL16_ARATH Agamous-like MADS-box protein AGL16 OS=Arabidopsis thaliana GN=AGL16 PE=1 SV=1
>gi|359806214|ref|NP_001240951.1| MADS-box protein SVP-like [Glycine max] gi|166014267|gb|ABY78023.1| short vegetative phase-like protein [Glycine max]
Binds DNA and exists as hetero and homo-dimers. Differs from SRF-like/Type I subgroup mainly in position of the alpha helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals. Also found in fungi. Length = 77
Binds DNA and exists as hetero and homo-dimers. Composed of 2 main subgroups: SRF-like/Type I and MEF2-like (myocyte enhancer factor 2)/ Type II. These subgroups differ mainly in position of the alpha 2 helix responsible for the dimerization interface; Important in homeotic regulation in plants and in immediate-early development in animals. Also found in fungi. Length = 59
>gnl|CDD|238166 cd00266, MADS_SRF_like, SRF-like/Type I subfamily of MADS (MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators
Score = 90.4 bits (225), Expect = 1e-25
Identities = 37/74 (50%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
Query: 2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFE-YSSS 60
R+KI+IK+I+N R VTFSKRR+G+FKKA ELS LC A+VA+I++S +GKL+ + SS
Sbjct: 1 GRKKIKIKRIENKKKRAVTFSKRRQGLFKKASELSTLCGAEVAVIVYSPSGKLYVFWPSS 60
Query: 61 SMKEILEKHRVHSK 74
++ ++ + V S
Sbjct: 61 EVEGVISRFEVLSA 74
Binds DNA and exists as hetero- and homo-dimers. Differs from the MEF-like/Type II subgroup mainly in position of the alpha 2 helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals. Also found in fungi. Length = 83
>gnl|CDD|109379 pfam00319, SRF-TF, SRF-type transcription factor (DNA-binding and dimerisation domain)
Binds DNA and exists as hetero and homo-dimers. Differs from SRF-like/Type I subgroup mainly in position of the alpha helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals. Also found in fungi.
>cd00266 MADS_SRF_like SRF-like/Type I subfamily of MADS (MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators
Probab=99.97 E-value=8.7e-32 Score=168.92 Aligned_cols=81 Identities=46% Similarity=0.742 Sum_probs=75.1
Q ss_pred CcccceeEEecCCCCcccccccccchhhhhhHhhhhccccceEEEEecCCCceeeccCCc-hHHHHHHhhhcccccccCC
Q 034384 2 AREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSSS-MKEILEKHRVHSKNLERVD 80 (96)
Q Consensus 2 gR~ki~i~~I~~~~~R~~tf~kRk~gL~kKa~Els~LC~~~v~liv~~~~g~~~~~~s~~-~~~vl~ry~~~s~~~~~~~ 80 (96)
||+||+|++|+|+..|++||+||+.||+|||+|||+|||++||+|||+|+|+.++|++++ ++++|++|..++..+++..
T Consensus 1 gr~Ki~i~~I~~~~~R~~tf~KRk~gl~kKa~ELs~Lc~~~v~~iv~sp~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~ 80 (83)
T cd00266 1 GRKKIKIKRIENKKKRAVTFSKRRQGLFKKASELSTLCGAEVAVIVYSPSGKLYVFWPSSEVEGVISRFEVLSALERKKK 80 (83)
T ss_pred CCccceeEEeeccchhhhhHHHhhhhHHHHHHHHHHhhCCcEEEEEECCCCCcceecCcHHHHHHHHHHhhcCHhhhhcc
Confidence 899999999999999999999999999999999999999999999999999999887755 9999999999998877655
Q ss_pred CC
Q 034384 81 QP 82 (96)
Q Consensus 81 ~~ 82 (96)
.+
T Consensus 81 ~~ 82 (83)
T cd00266 81 AV 82 (83)
T ss_pred CC
Confidence 43
Binds DNA and exists as hetero- and homo-dimers. Differs from the MEF-like/Type II subgroup mainly in position of the alpha 2 helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals. Also found in fungi.
Binds DNA and exists as hetero and homo-dimers. Composed of 2 main subgroups: SRF-like/Type I and MEF2-like (myocyte enhancer factor 2)/ Type II. These subgroups differ mainly in position of the alpha 2 helix responsible for the dimerization interface; Important in homeotic regulation in plants and in immediate-early development in animals. Also found in fungi.
>PF00319 SRF-TF: SRF-type transcription factor (DNA-binding and dimerisation domain); InterPro: IPR002100 Human serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation
SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation []. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic alpha-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel beta-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see IPR002487 from INTERPRO ; GO: 0003677 DNA binding, 0046983 protein dimerization activity; PDB: 1MNM_B 1N6J_A 1TQE_S 3MU6_D 3P57_I 1EGW_A 1C7U_B 3KOV_A 1HBX_A 1K6O_C ....
>KOG0015 consensus Regulator of arginine metabolism and related MADS box-containing transcription factors [Transcription]
>pdb|3KOV|A Chain A, Structure Of Mef2a Bound To Dna Reveals A Completely Folded Mads-BoxMEF2 DOMAIN THAT RECOGNIZES DNA AND RECRUITS Transcription Co-Factors Length = 90