Citrus Sinensis ID: 034393

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MVCEKCEKKLSKVIVPDKWKEGASNTTEAGGRKVNENKLLSKKKRWTPYGNTKCIICKQQVHQDAKYCHTCAYSKGVCAMCGKQVLDTKFYKQSNV
ccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccc
MVCEKCEKKLSKVIVPD*************************KKRWTPYGNTKCIICKQQVHQDAKYCHTCAYSKGVCAMCGKQVLDTKFYKQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCEKCEKKLSKVIVPDKWKEGASNTTEAGGRKVNENKLLSKKKRWTPYGNTKCIICKQQVHQDAKYCHTCAYSKGVCAMCGKQVLDTKFYKQSNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine-rich PDZ-binding protein probableQ5ZKB6
Cysteine-rich PDZ-binding protein Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.probableQ3ZC66
Cysteine-rich PDZ-binding protein Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.probableO70333

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M3V, chain A
Confidence level:probable
Coverage over the Query: 53-74
View the alignment between query and template
View the model in PyMOL