Citrus Sinensis ID: 034400


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFREGTQAAPRKKGAAASA
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccc
**********RRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRR**TGTGRMRYLRHVPRRFKS*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFREGTQAAPRKKGAAASA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L37-A Binds to the 23S rRNA.confidentP49166
60S ribosomal protein L37-3 Binds to the 23S rRNA.confidentQ8LEM8
Probable 60S ribosomal protein L37-A Binds to the 23S rRNA.confidentQ9VXX8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain 2
Confidence level:very confident
Coverage over the Query: 3-53
View the alignment between query and template
View the model in PyMOL