Citrus Sinensis ID: 034423


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MAATDSPSSTRKVVVHFRATGGAPILKQAKFKISGSDKFAKVIEFLCRHLGRETLFVYVNSAFSPNPDELVIDLYNNFGFDGKLIVNYACSMAWG
ccccccccccccEEEEEEEccccccccccEEEECcccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccc
************VVVHFRATGGAPILKQAKFKISGSDKFAKVIEFLCRHLGRETLFVYVNSAFSPNPDELVIDLYNNFGFDGKLIVNYACSMAWG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATDSPSSTRKVVVHFRATGGAPILKQAKFKISGSDKFAKVIEFLCRHLGRETLFVYVNSAFSPNPDELVIDLYNNFGFDGKLIVNYACSMAWG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-like protein ATG12B Ubiquitin-like protein involved in cytoplasm to vacuole transport (Cvt) and autophagy vesicles formation. Conjugation with ATG5 through an ubiquitin-like conjugating system involving also ATG7 as an E1-like activating enzyme and ATG10 as an E2-like conjugating enzyme, is essential for its function. ATG12/ATG5 conjugate has an essential role in plant nutrient recycling.confidentQ9LVK3
Ubiquitin-like protein ATG12 Ubiquitin-like protein involved in cytoplasm to vacuole transport (Cvt) and autophagy vesicles formation. Conjugation with ATG5 through an ubiquitin-like conjugating system is essential for its function. ATG12/ATG5 conjugate has an essential role in plant nutrient recycling.probableQ1SF86
Ubiquitin-like protein ATG12 Ubiquitin-like protein involved in cytoplasm to vacuole transport (Cvt) and autophagy vesicles formation. Conjugation with ATG5 through an ubiquitin-like conjugating system is essential for its function. ATG12/ATG5 conjugate has an essential role in plant nutrient recycling.probableQ69NP0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WZ3, chain A
Confidence level:very confident
Coverage over the Query: 11-94
View the alignment between query and template
View the model in PyMOL