Citrus Sinensis ID: 034429

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
METSAASGGPGGLGGGPAPFLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYVQIIINKSFLWNHDNAV
cccccccccccccccccccHHHHHHHHHccccccccCEEccccccEEEcccHHHHHHcccccccccccHHHHHHHHccccEEccccccccccccc
******************PFLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYVQIIINKSFLWN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METSAASGGPGGLGGGPAPFLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTYFKHNNFSSFIRQLNTYVQIIINKSFLWNHDNAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat stress transcription factor A-5 Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).probableQ94BZ5
Heat stress transcription factor B-4b Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE).probableQ7XHZ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HTS, chain B
Confidence level:very confident
Coverage over the Query: 15-94
View the alignment between query and template
View the model in PyMOL