Citrus Sinensis ID: 034452

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MNVEEEVERLKEEIQRLGKIQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKFLTYDGELLLQGVHDNVEITLKPPPPQPLAVAAAAES
ccHHHHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHcccEEEccEEEEccccccEEEEEccccccHHHHHHHHcc
*NVEEEVERLKEEIQRLG*IQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKFLTYDGELLLQGVHDNVEITLKPPPPQ***V******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVEEEVERLKEEIQRLGKIQPDGSYKVTFGVLFHDDRCANIFEALVGTLRAAKKRKFLTYDGELLLQGVHDNVEITLKPPPPQPLAVAAAAES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Costars family protein confidentQ6AVK1
Costars family protein At4g33640 confidentQ8LBN7
Costars family protein ABRACL confidentQ4KML4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L2O, chain A
Confidence level:very confident
Coverage over the Query: 1-84
View the alignment between query and template
View the model in PyMOL