Citrus Sinensis ID: 034469

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MASSKGGGMEKMSVEQLKAIKEQTDLEVNLLQDSLNNIRTATSRLESASTALHDLSLRPQGAKMLVPLTASLYVPGTLDDARKVLVDIGTENDG
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccCEEEEccccEEEcCEEccccEEEEEEcccccc
***********MS***LKAIKEQTDLEVNLLQDSLNNIRTATSRLESASTA*********GAKMLVPLTASLYVPGTLDDARKVLVDIGTE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSKGGGMEKMSVEQLKAIKEQTDLEVNLLQDSLNNIRTATSRLESASTALHDLSLRPQGAKMLVPLTASLYVPGTLDDARKVLVDIGTENDG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable prefoldin subunit 5 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.probableP57742

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FXK, chain C
Confidence level:very confident
Coverage over the Query: 13-93
View the alignment between query and template
View the model in PyMOL