Citrus Sinensis ID: 034507


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MAVVDTLSTHSPDEEYLGERQQPWIWSGDGEITEAFFEFSAEIGRIEKEIEKRNSDPSRRNRCGAGVLPYELLVPSSEPGVTCKGVPNSVSI
ccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccCEEECcccccccccccccccccc
MAVVDTLSTHSPDEEYLGERQQPWIWSGDGEITEAFFEFSAEIGRIEKEIEKRNSDPSRRNRCGAGVLPYELLVPSSEPGVTCKGVPNSVSI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVVDTLSTHSPDEEYLGERQQPWIWSGDGEITEAFFEFSAEIGRIEKEIEKRNSDPSRRNRCGAGVLPYELLVPSSEPGVTCKGVPNSVSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoxygenase 3, chloroplastic 13S-lipoxygenase that can use linolenic acid as substrates. Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure.probableQ9LNR3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IUJ, chain A
Confidence level:very confident
Coverage over the Query: 1-92
View the alignment between query and template
View the model in PyMOL