Citrus Sinensis ID: 034530


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MIDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF
cccccEEccccccccEEEcccccccccccHHHHHHccccEEcccccccEEEccHHHHcccccccEEEccccccccccccccHHHHHHHHHcc
ccHHHHHHcccccccEEEcccccccccHHHHHHccHHHHHEEcccccccccEcHHHHHHcccccEEEcccccccccEEcccHHHHHHHHHcc
MIDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLrelhlrdtgfkgtfdvrefdsfnnlevldlswneidnlvvpqgkqlkcYLITLF
midkfvvskglsklkslglagiklNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIdnlvvpqgkqlkcylitlf
MIDKFVVskglsklkslglagiklNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF
****FVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITL*
MIDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF
MIDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF
MIDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGKQLKCYLITLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query92 2.2.26 [Sep-21-2011]
Q3E991 659 Probable inactive leucine yes no 0.760 0.106 0.458 4e-06
>sp|Q3E991|Y5269_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At5g20690 OS=Arabidopsis thaliana GN=At5g20690 PE=2 SV=4 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 9   KGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDL 68
           K +SKLK L L   K   SI SS+T    L ELH++     G     EF S  NL+VLDL
Sbjct: 141 KDMSKLKRLFLDHNKFEGSIPSSITQLPQLEELHMQSNNLTGEIPP-EFGSMKNLKVLDL 199

Query: 69  SWNEIDNLVVPQ 80
           S N +D  +VPQ
Sbjct: 200 STNSLDG-IVPQ 210





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
224142513 290 predicted protein [Populus trichocarpa] 0.706 0.224 0.492 4e-08
297745116139 unnamed protein product [Vitis vinifera] 0.847 0.561 0.419 2e-07
359482757 1027 PREDICTED: LRR receptor-like serine/thre 0.858 0.076 0.376 8e-07
359483099 1231 PREDICTED: probable LRR receptor-like se 0.793 0.059 0.421 1e-06
359483163 1047 PREDICTED: LRR receptor-like serine/thre 0.663 0.058 0.491 4e-06
359482740 1093 PREDICTED: receptor-like protein 12-like 0.847 0.071 0.382 7e-06
297743520 450 unnamed protein product [Vitis vinifera] 0.847 0.173 0.369 1e-05
359482745 1026 PREDICTED: leucine-rich repeat receptor 0.847 0.076 0.369 1e-05
359482725 1144 PREDICTED: leucine-rich repeat receptor 0.847 0.068 0.369 2e-05
359482731 918 PREDICTED: probable LRR receptor-like se 0.858 0.086 0.364 3e-05
>gi|224142513|ref|XP_002324601.1| predicted protein [Populus trichocarpa] gi|222866035|gb|EEF03166.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 62.0 bits (149), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%)

Query: 11  LSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSW 70
           L+KL+SL L     N SILSS    SSL+ ++L     KG+ D++EFDS + L+ LDLS 
Sbjct: 141 LTKLESLDLGLNNFNNSILSSFKGLSSLKHIYLESNQLKGSIDIKEFDSLSKLQELDLSR 200

Query: 71  NEIDNLVVPQG 81
           NEI NLV   G
Sbjct: 201 NEIQNLVTSTG 211




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297745116|emb|CBI38955.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482757|ref|XP_002268914.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483099|ref|XP_002262931.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483163|ref|XP_002263908.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482740|ref|XP_003632823.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743520|emb|CBI36387.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482745|ref|XP_003632825.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482725|ref|XP_003632817.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482731|ref|XP_003632819.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
TAIR|locus:2180409 659 PRK6 "pollen receptor like kin 0.565 0.078 0.462 0.00018
TAIR|locus:2180409 PRK6 "pollen receptor like kinase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 102 (41.0 bits), Expect = 0.00018, P = 0.00018
 Identities = 25/54 (46%), Positives = 31/54 (57%)

Query:    27 SILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQ 80
             SI SS+T    L ELH++     G     EF S  NL+VLDLS N +D  +VPQ
Sbjct:   159 SIPSSITQLPQLEELHMQSNNLTGEIPP-EFGSMKNLKVLDLSTNSLDG-IVPQ 210


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.326   0.142   0.414    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       92        75   0.00091  102 3  11 22  0.46    28
                                                     29  0.47    29


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  497 (53 KB)
  Total size of DFA:  94 KB (2069 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  9.38u 0.10s 9.48t   Elapsed:  00:00:00
  Total cpu time:  9.38u 0.10s 9.48t   Elapsed:  00:00:00
  Start:  Thu May  9 18:38:03 2013   End:  Thu May  9 18:38:03 2013


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XVIII001033
hypothetical protein (290 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.4097.1.1
hypothetical protein (226 aa)
       0.461
eugene3.00110941
hypothetical protein (581 aa)
       0.432
gw1.V.3546.1
hypothetical protein (531 aa)
       0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.28
PLN03150 623 hypothetical protein; Provisional 99.13
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.86
PLN03150 623 hypothetical protein; Provisional 98.83
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.83
KOG0617 264 consensus Ras suppressor protein (contains leucine 98.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.63
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.51
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.5
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.36
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.35
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.34
KOG0617 264 consensus Ras suppressor protein (contains leucine 98.2
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.13
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.06
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.04
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.04
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.0
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.89
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 97.87
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.82
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.82
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.64
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.62
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.54
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.53
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.48
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.46
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.43
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.43
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.42
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.36
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.28
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.01
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.85
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.81
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.79
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 96.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.61
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.33
smart0037026 LRR Leucine-rich repeats, outliers. 96.17
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.17
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 96.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 96.09
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.02
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 95.99
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 95.84
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.83
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.79
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 94.67
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.62
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.32
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.03
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 93.85
KOG2982 418 consensus Uncharacterized conserved protein [Funct 93.12
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.9
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.9
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 91.89
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 90.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 89.49
PRK15386 426 type III secretion protein GogB; Provisional 86.1
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 85.11
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 84.81
KOG3864221 consensus Uncharacterized conserved protein [Funct 84.69
KOG1947 482 consensus Leucine rich repeat proteins, some prote 84.1
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 80.44
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
Probab=99.28  E-value=3.4e-12  Score=64.72  Aligned_cols=61  Identities=30%  Similarity=0.396  Sum_probs=55.3

Q ss_pred             CCCCEEeccCccCCCCChhhhhcCCCCcEEecCCCccCCccChhhcCCCCCCCEEeccCCcC
Q 034530           12 SKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEI   73 (92)
Q Consensus        12 ~~L~~l~ls~n~l~~~~~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~~~L~~l~ls~N~l   73 (92)
                      |+|+.+++++|++....+..|..+++|+.+++++|.++...+ +.|.++++|+++++++|++
T Consensus         1 p~L~~L~l~~n~l~~i~~~~f~~l~~L~~L~l~~N~l~~i~~-~~f~~l~~L~~L~l~~N~l   61 (61)
T PF13855_consen    1 PNLESLDLSNNKLTEIPPDSFSNLPNLETLDLSNNNLTSIPP-DAFSNLPNLRYLDLSNNNL   61 (61)
T ss_dssp             TTESEEEETSSTESEECTTTTTTGTTESEEEETSSSESEEET-TTTTTSTTESEEEETSSSB
T ss_pred             CcCcEEECCCCCCCccCHHHHcCCCCCCEeEccCCccCccCH-HHHcCCCCCCEEeCcCCcC
Confidence            578999999999998777789999999999999999996665 6799999999999999985



...

>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 8e-04
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
 Score = 41.2 bits (97), Expect = 8e-06
 Identities = 19/75 (25%), Positives = 29/75 (38%)

Query: 2   IDKFVVSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFN 61
           + +F V   L  L  L ++      +        SSL  L +    F+  F    F    
Sbjct: 411 MSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELR 470

Query: 62  NLEVLDLSWNEIDNL 76
           NL  LDLS  +++ L
Sbjct: 471 NLTFLDLSQCQLEQL 485


>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.32
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.31
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.3
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.29
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.28
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.28
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.25
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.25
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.24
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.23
3m19_A 251 Variable lymphocyte receptor A diversity region; a 99.23
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.21
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.21
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.19
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.18
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.15
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.14
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.1
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.1
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.1
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.1
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.1
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.07
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.05
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.03
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.03
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.03
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.02
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.01
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.01
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.01
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.0
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.0
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.0
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.0
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.99
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.99
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.99
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.99
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.99
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.98
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.97
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.96
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.96
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.94
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.94
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.93
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.92
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.91
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 98.9
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.9
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.9
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.89
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.88
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.87
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.87
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.87
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.87
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.87
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 98.86
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.86
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.77
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.76
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.75
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.74
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.74
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.72
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.72
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.7
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.69
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.53
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.47
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.46
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.45
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.41
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.4
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.39
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.37
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.37
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.37
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.36
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.31
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.12
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.0
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.89
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.71
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.6
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.59
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.42
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.27
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.83
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.79
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.71
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.62
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.87
4gt6_A394 Cell surface protein; leucine rich repeats, putati 94.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.19
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
Probab=99.38  E-value=1.3e-12  Score=78.54  Aligned_cols=74  Identities=22%  Similarity=0.205  Sum_probs=62.3

Q ss_pred             cCCCCCCCEEeccCccCCCCChhhhhcCCCCcEEecCCCccCCccChhhcCCCCCCCEEeccCCcCCCcCCCCCc
Q 034530            8 SKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGK   82 (92)
Q Consensus         8 l~~l~~L~~l~ls~n~l~~~~~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~~~L~~l~ls~N~l~~~~~~~~~   82 (92)
                      ++.+++|+.|++++|.+++..|..+..+++|+.|++++|++++..+ ..|.++++|++|++++|++++..+....
T Consensus        50 ~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~-~~~~~l~~L~~L~L~~N~l~~~~~~~~~  123 (192)
T 1w8a_A           50 FGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISN-KMFLGLHQLKTLNLYDNQISCVMPGSFE  123 (192)
T ss_dssp             GGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSCCCCEECS-SSSTTCTTCCEEECCSSCCCEECTTSST
T ss_pred             cccCCCCCEEECCCCCCCCcCHhHcCCcccCCEEECCCCcCCccCH-HHhcCCCCCCEEECCCCcCCeeCHHHhh
Confidence            6778899999999999998878888889999999999999987766 4588889999999999999888776433



>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 92
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: 28-residue LRR
domain: Ribonuclease inhibitor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 35.7 bits (80), Expect = 3e-04
 Identities = 16/83 (19%), Positives = 34/83 (40%), Gaps = 5/83 (6%)

Query: 14 LKSLGLAGIKLNRSILSSL-TVFSSLRELHLRDTGF--KGTFDVREFDSFN-NLEVLDLS 69
          ++SL +   +L+ +  + L  +    + + L D G       D+      N  L  L+L 
Sbjct: 4  IQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLR 63

Query: 70 WNEIDNLVVPQ-GKQLKCYLITL 91
           NE+ ++ V    + L+     +
Sbjct: 64 SNELGDVGVHCVLQGLQTPSCKI 86


>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.16
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.14
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.12
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.11
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.03
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.98
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.95
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.89
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.89
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.87
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.83
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.81
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.79
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.71
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.42
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.16
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.14
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.74
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.68
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.67
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.49
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.49
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.57
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.48
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.67
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.34  E-value=1.2e-12  Score=77.17  Aligned_cols=75  Identities=21%  Similarity=0.210  Sum_probs=58.5

Q ss_pred             ccCCCCCCCEEeccCccCCCCChhhhhcCCCCcEEecCCCccCCccChhhcCCCCCCCEEeccCCcCCCcCCCCCc
Q 034530            7 VSKGLSKLKSLGLAGIKLNRSILSSLTVFSSLRELHLRDTGFKGTFDVREFDSFNNLEVLDLSWNEIDNLVVPQGK   82 (92)
Q Consensus         7 ~l~~l~~L~~l~ls~n~l~~~~~~~~~~~~~L~~l~l~~n~l~~~~~~~~~~~~~~L~~l~ls~N~l~~~~~~~~~   82 (92)
                      .+..+++|+.|++++|.+....+..+..+++|+.+++++|++....+ +.|.++++|++|+|++|+++++++..+.
T Consensus        49 ~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~Ls~N~l~~l~~-~~F~~l~~L~~L~L~~N~l~~i~~~~f~  123 (192)
T d1w8aa_          49 LFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISN-KMFLGLHQLKTLNLYDNQISCVMPGSFE  123 (192)
T ss_dssp             SGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSCCCCEECS-SSSTTCTTCCEEECCSSCCCEECTTSST
T ss_pred             ccCCCceEeeeeccccccccccccccccccccceeeeccccccccCH-HHHhCCCcccccccCCccccccCHHHhc
Confidence            45667888888888888887777777788888888888888886555 5688888888888888888888776443



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure