Citrus Sinensis ID: 034546

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MDKRRRKQAKTTTTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAFADRRRELRIYNSKS
ccccccccccccccccccccccccHHccccccHHHHHHHHHHHHHHHcHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccc
ccccccccccccccccccEEEcccEEEEEcccHcHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHcccccccc
mdkrrrkqakttttTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALiagripgrkaeEIERFWIMRHGQAFADRRRELRIYNSKS
mdkrrrkqaktttttfyseevssiewEFINMSEQEEDLIYRMYKLVGDRWALIagripgrkaeeierFWIMRhgqafadrrrelriynsks
MDKRRRKQAKtttttFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAFADRRRELRIYNSKS
**************TFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAFADR***********
************TTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMR*******************
***************FYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAFADRRRELRIYNSKS
*****************SEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQ****************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKRRRKQAKTTTTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAFADRRRELRIYNSKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q8GV05106 Transcription factor TRY yes no 0.945 0.811 0.681 2e-28
O2205994 Transcription factor CPC no no 0.901 0.872 0.702 5e-28
Q9LTF7201 Transcription factor MYB8 no no 0.428 0.194 0.615 2e-09
P27900228 Trichome differentiation no no 0.439 0.175 0.55 9e-09
Q9SEI0203 Transcription factor WER no no 0.439 0.197 0.55 9e-09
Q947R4223 Trichome differentiation no no 0.439 0.179 0.55 1e-08
P10290 273 Anthocyanin regulatory C1 N/A no 0.439 0.146 0.575 1e-08
Q96276219 Transcription factor MYB2 no no 0.439 0.182 0.525 2e-08
Q38850 249 Transcription repressor M no no 0.428 0.156 0.564 3e-08
Q9FJA2 258 Transcription factor TT2 no no 0.439 0.155 0.55 5e-08
>sp|Q8GV05|TRY_ARATH Transcription factor TRY OS=Arabidopsis thaliana GN=TRY PE=1 SV=1 Back     alignment and function desciption
 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (81%), Gaps = 2/88 (2%)

Query: 3  KRRRKQAKTTTTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKA 62
          +RRRKQ K       SEEVSSIEWEFINM+EQEEDLI+RMY+LVGDRW LIAGR+PGR+ 
Sbjct: 7  RRRRKQHKIALHD--SEEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQP 64

Query: 63 EEIERFWIMRHGQAFADRRRELRIYNSK 90
          EEIER+WIMR+ + FAD+RR+L   + K
Sbjct: 65 EEIERYWIMRNSEGFADKRRQLHSSSHK 92
Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation.
Arabidopsis thaliana (taxid: 3702)
>sp|O22059|CPC_ARATH Transcription factor CPC OS=Arabidopsis thaliana GN=CPC PE=1 SV=1 Back     alignment and function description
>sp|Q9LTF7|MYB82_ARATH Transcription factor MYB82 OS=Arabidopsis thaliana GN=MYB82 PE=1 SV=1 Back     alignment and function description
>sp|P27900|GL1_ARATH Trichome differentiation protein GL1 OS=Arabidopsis thaliana GN=GL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 Back     alignment and function description
>sp|Q947R4|GL1_ARALY Trichome differentiation protein GL1 OS=Arabidopsis lyrata GN=GL1 PE=3 SV=2 Back     alignment and function description
>sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 Back     alignment and function description
>sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 Back     alignment and function description
>sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
38000641383 caprice [Gossypium arboreum] gi|38000641 0.901 0.987 0.857 1e-33
38000641189 triptychon [Gossypium arboreum] 0.923 0.943 0.825 6e-33
22413050488 predicted protein [Populus trichocarpa] 0.967 1.0 0.775 2e-32
25556475989 triptychon and cpc, putative [Ricinus co 0.978 1.0 0.752 2e-32
22406796480 predicted protein [Populus trichocarpa] 0.879 1.0 0.839 8e-31
22545448588 PREDICTED: transcription factor TRY [Vit 0.956 0.988 0.806 4e-28
22546272788 PREDICTED: transcription factor TRY [Vit 0.901 0.931 0.759 1e-27
25554505075 triptychon and cpc, putative [Ricinus co 0.824 1.0 0.792 6e-27
297792687106 hypothetical protein ARALYDRAFT_357563 [ 0.945 0.811 0.681 8e-27
30696297106 transcription factor TRY [Arabidopsis th 0.945 0.811 0.681 9e-27
>gi|380006413|gb|AFD29597.1| caprice [Gossypium arboreum] gi|380006419|gb|AFD29600.1| CPC-like protein [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/84 (85%), Positives = 76/84 (90%), Gaps = 2/84 (2%)

Query: 1  MDKRRRKQAKTTTTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGR 60
          MD RRRKQ KT+     SEEVSSIEWEFINMSEQEEDLIYRMYKLVGD+WALIAGRIPGR
Sbjct: 1  MDGRRRKQPKTSGCC--SEEVSSIEWEFINMSEQEEDLIYRMYKLVGDKWALIAGRIPGR 58

Query: 61 KAEEIERFWIMRHGQAFADRRREL 84
          KAEEIERFWIMRHG+ FA+RRREL
Sbjct: 59 KAEEIERFWIMRHGEGFANRRREL 82

Source: Gossypium arboreum

Species: Gossypium arboreum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|380006411|gb|AFD29596.1| triptychon [Gossypium arboreum] Back     alignment and taxonomy information
>gi|224130504|ref|XP_002320853.1| predicted protein [Populus trichocarpa] gi|222861626|gb|EEE99168.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255564759|ref|XP_002523374.1| triptychon and cpc, putative [Ricinus communis] gi|223537462|gb|EEF39090.1| triptychon and cpc, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224067964|ref|XP_002302621.1| predicted protein [Populus trichocarpa] gi|222844347|gb|EEE81894.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225454485|ref|XP_002281055.1| PREDICTED: transcription factor TRY [Vitis vinifera] gi|147832303|emb|CAN77791.1| hypothetical protein VITISV_033192 [Vitis vinifera] gi|297745414|emb|CBI40494.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462727|ref|XP_002268795.1| PREDICTED: transcription factor TRY [Vitis vinifera] gi|158323782|gb|ABW34395.1| Myb-related TRIPTYCHON-like protein [Vitis vinifera] gi|302143684|emb|CBI22545.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545050|ref|XP_002513586.1| triptychon and cpc, putative [Ricinus communis] gi|223547494|gb|EEF48989.1| triptychon and cpc, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297792687|ref|XP_002864228.1| hypothetical protein ARALYDRAFT_357563 [Arabidopsis lyrata subsp. lyrata] gi|297310063|gb|EFH40487.1| hypothetical protein ARALYDRAFT_357563 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30696297|ref|NP_200132.2| transcription factor TRY [Arabidopsis thaliana] gi|75328865|sp|Q8GV05.1|TRY_ARATH RecName: Full=Transcription factor TRY; AltName: Full=Protein TRIPTYCHON gi|26516846|gb|AAN78321.1| TRIPTYCHON [Arabidopsis thaliana] gi|41618970|gb|AAS09993.1| MYB transcription factor [Arabidopsis thaliana] gi|88900370|gb|ABD57497.1| At5g53200 [Arabidopsis thaliana] gi|332008938|gb|AED96321.1| transcription factor TRY [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:2163766106 TRY "TRIPTYCHON" [Arabidopsis 0.945 0.811 0.681 6.4e-28
TAIR|locus:200550394 CPC "CAPRICE" [Arabidopsis tha 0.890 0.861 0.710 2.2e-27
TAIR|locus:2064352112 ETC2 "ENHANCER OF TRY AND CPC 0.857 0.696 0.653 2.3e-23
TAIR|locus:4515102929100 TCL2 "TRICHOMELESS 2" [Arabido 0.868 0.79 0.567 1.3e-20
TAIR|locus:100902316284 TCL1 "TRICHOMELESS1" [Arabidop 0.692 0.75 0.682 5.7e-20
TAIR|locus:212500877 CPL3 "CAPRICE-like MYB3" [Arab 0.802 0.948 0.623 5.7e-20
TAIR|locus:203528783 ETC1 "ENHANCER OF TRY AND CPC 0.692 0.759 0.691 1.2e-19
TAIR|locus:504955052201 MYB82 "myb domain protein 82" 0.439 0.199 0.6 5.2e-10
TAIR|locus:2185470203 MYB66 "myb domain protein 66" 0.439 0.197 0.55 2.9e-09
TAIR|locus:2086475228 MYB0 "myb domain protein 0" [A 0.439 0.175 0.55 3.7e-09
TAIR|locus:2163766 TRY "TRIPTYCHON" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 312 (114.9 bits), Expect = 6.4e-28, P = 6.4e-28
 Identities = 60/88 (68%), Positives = 72/88 (81%)

Query:     3 KRRRKQAKXXXXXFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKA 62
             +RRRKQ K       SEEVSSIEWEFINM+EQEEDLI+RMY+LVGDRW LIAGR+PGR+ 
Sbjct:     7 RRRRKQHKIALHD--SEEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQP 64

Query:    63 EEIERFWIMRHGQAFADRRRELRIYNSK 90
             EEIER+WIMR+ + FAD+RR+L   + K
Sbjct:    65 EEIERYWIMRNSEGFADKRRQLHSSSHK 92
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0010091 "trichome branching" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0001708 "cell fate specification" evidence=RCA
GO:0009913 "epidermal cell differentiation" evidence=RCA
TAIR|locus:2005503 CPC "CAPRICE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064352 ETC2 "ENHANCER OF TRY AND CPC 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102929 TCL2 "TRICHOMELESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023162 TCL1 "TRICHOMELESS1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125008 CPL3 "CAPRICE-like MYB3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035287 ETC1 "ENHANCER OF TRY AND CPC 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955052 MYB82 "myb domain protein 82" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2185470 MYB66 "myb domain protein 66" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086475 MYB0 "myb domain protein 0" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GV05TRY_ARATHNo assigned EC number0.68180.94500.8113yesno
O22059CPC_ARATHNo assigned EC number0.70230.90100.8723nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
PLN03212 249 PLN03212, PLN03212, Transcription repressor MYB5; 2e-11
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-07
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 3e-04
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 5e-04
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score = 57.4 bits (138), Expect = 2e-11
 Identities = 22/39 (56%), Positives = 32/39 (82%)

Query: 31  MSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFW 69
           ++  EEDLI R+++L+G+RW+LIAGRIPGR   EI+ +W
Sbjct: 81  ITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYW 119

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.95
PLN03212 249 Transcription repressor MYB5; Provisional 99.94
PLN03091 459 hypothetical protein; Provisional 99.92
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.62
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.52
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.47
PLN03212 249 Transcription repressor MYB5; Provisional 99.45
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.43
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.35
PLN03091 459 hypothetical protein; Provisional 99.19
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.14
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.67
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.66
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.42
KOG0051 607 consensus RNA polymerase I termination factor, Myb 97.95
COG5147 512 REB1 Myb superfamily proteins, including transcrip 97.9
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.83
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.77
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.61
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.53
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.52
KOG0051607 consensus RNA polymerase I termination factor, Myb 97.46
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.28
PRK13923170 putative spore coat protein regulator protein YlbO 96.66
KOG1279 506 consensus Chromatin remodeling factor subunit and 96.62
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 96.61
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.6
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.19
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 95.46
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 94.6
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 94.48
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 94.31
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 93.85
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 92.18
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 92.16
PLN031421033 Probable chromatin-remodeling complex ATPase chain 91.36
KOG1194 534 consensus Predicted DNA-binding protein, contains 90.79
KOG4282 345 consensus Transcription factor GT-2 and related pr 90.35
KOG2656 445 consensus DNA methyltransferase 1-associated prote 90.04
PF1142750 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C 86.49
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 85.7
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 85.49
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 82.0
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 81.33
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information 
Probab=99.95  E-value=6.8e-29  Score=182.98  Aligned_cols=74  Identities=32%  Similarity=0.627  Sum_probs=70.4

Q ss_pred             ccchhhhhccccccCCccccCCCcccCCCCHHHHHHHHHHHHHhCCcHHHHhhhCCCCCHHHHHHHHHHHhhHHHHHHH
Q 034546            3 KRRRKQAKTTTTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAFADRR   81 (91)
Q Consensus         3 ~~~~~q~~~~~~~~~s~~v~s~~lkkg~wT~eED~lLi~l~~~~G~kW~~Ia~~lpGRt~n~vKnrw~~~l~k~~~~~~   81 (91)
                      +|.+|+||.||.+||.|.|.     +|+||+|||++||++|..+||+|+.||++|||||||+|||+|++++++++....
T Consensus        42 ~R~GKSCRlRW~NyLrP~ik-----rg~fT~eEe~~Ii~lH~~~GNrWs~IA~~LPGRTDNeIKN~Wnt~lkkkl~~~~  115 (238)
T KOG0048|consen   42 RRCGKSCRLRWTNYLRPDLK-----RGNFSDEEEDLIIKLHALLGNRWSLIAGRLPGRTDNEVKNHWNTHLKKKLLKMG  115 (238)
T ss_pred             CccchHHHHHhhcccCCCcc-----CCCCCHHHHHHHHHHHHHHCcHHHHHHhhCCCcCHHHHHHHHHHHHHHHHHHcC
Confidence            79999999999999987766     599999999999999999999999999999999999999999999999998766

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF11427 HTH_Tnp_Tc3_1: Tc3 transposase; PDB: 1U78_A 1TC3_C Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 1e-04
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-04
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 2e-04
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-04
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 6e-04
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 6e-04
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure 
Iteration: 1

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 5/63 (7%)
Query: 7   KQAKXXXXXFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIE 66
           KQ +       + EV    W     +E+E+ +IY+ +K +G+RWA IA  +PGR    I+
Sbjct: 94  KQCRERWHNHLNPEVKKTSW-----TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIK 148
Query: 67  RFW 69
             W
Sbjct: 149 NHW 151
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-08
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-08
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 5e-08
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-06
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 8e-06
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 2e-05
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score = 46.0 bits (110), Expect = 3e-08
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 32 SEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFW 69
          +E+E+ +IY+ +K +G+RWA IA  +PGR    I+  W
Sbjct: 60 TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHW 97
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.94
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.94
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.94
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.93
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.93
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.92
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.88
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.87
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.85
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.84
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.82
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.82
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.81
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.8
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.79
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.64
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.77
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.77
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.75
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.75
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.71
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.71
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.67
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.66
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.62
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.59
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.58
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.57
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.57
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.55
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.53
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.53
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.52
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.49
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.46
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.37
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 99.37
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.3
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.19
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.18
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.96
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.89
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.81
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.76
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.65
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 98.03
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.59
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.46
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 98.33
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.21
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.18
2crg_A70 Metastasis associated protein MTA3; transcription 98.07
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.86
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 97.81
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 97.8
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 97.6
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 97.49
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.41
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 97.18
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 97.13
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 96.72
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 96.7
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 96.61
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 96.59
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 95.93
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 95.73
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 95.43
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.29
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.55
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 93.49
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 94.45
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.43
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 94.37
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.7
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 92.87
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 91.31
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 86.4
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 86.13
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 84.51
2cjj_A93 Radialis; plant development, DNA-binding protein, 84.11
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 81.08
2yqf_A111 Ankyrin-1; death domain, structural genomics, NPPS 80.51
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=99.94  E-value=1.5e-27  Score=154.96  Aligned_cols=72  Identities=29%  Similarity=0.506  Sum_probs=65.7

Q ss_pred             CCccchhhhhccccccCCccccCCCcccCCCCHHHHHHHHHHHHHhCCcHHHHhhhCCCCCHHHHHHHHHHHhhHHH
Q 034546            1 MDKRRRKQAKTTTTTFYSEEVSSIEWEFINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHGQAF   77 (91)
Q Consensus         1 ~~~~~~~q~~~~~~~~~s~~v~s~~lkkg~wT~eED~lLi~l~~~~G~kW~~Ia~~lpGRt~n~vKnrw~~~l~k~~   77 (91)
                      |++|+.+||++||.++++|.+     ++|+||+|||++|+.++..+|++|+.||.+|||||+++|+|||+.++++++
T Consensus        34 l~~Rt~~qcr~Rw~~~l~p~~-----~~~~Wt~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           34 LKGRIGKQCRERWHNHLNPEV-----KKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             STTCCHHHHHHHHHHTTCCCC-----CCCCCCHHHHHHHHHHHHHHSSCHHHHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             hcCCCHHHHHHHHHhccCCcc-----cccCCCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            789999999999999998765     559999999999999999999999999999999999999999999988753
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2yqf_A Ankyrin-1; death domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yvi_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-04
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Nuclear receptor corepressor 2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.5 bits (79), Expect = 2e-04
 Identities = 8/42 (19%), Positives = 17/42 (40%)

Query: 32 SEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRH 73
          SEQE++     +      + LIA  +  +   E   ++ +  
Sbjct: 21 SEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTK 62

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.87
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.81
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.74
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.7
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.68
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.65
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.64
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.57
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.57
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.54
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.53
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.45
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.45
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.44
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.97
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.54
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.49
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.2
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.99
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.92
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.72
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.7
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 96.54
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 96.1
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 95.98
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 95.93
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 94.19
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 93.87
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 93.14
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.09
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 86.45
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 85.82
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 82.46
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.87  E-value=7.4e-23  Score=116.57  Aligned_cols=47  Identities=34%  Similarity=0.642  Sum_probs=45.1

Q ss_pred             cCCCCHHHHHHHHHHHHHhCCcHHHHhhhCCCCCHHHHHHHHHHHhh
Q 034546           28 FINMSEQEEDLIYRMYKLVGDRWALIAGRIPGRKAEEIERFWIMRHG   74 (91)
Q Consensus        28 kg~wT~eED~lLi~l~~~~G~kW~~Ia~~lpGRt~n~vKnrw~~~l~   74 (91)
                      ++|||+|||++|++++.++|++|+.||.+|||||+++|+|||+.+++
T Consensus         1 K~~WT~eED~~L~~~v~~~G~~W~~Ia~~~~gRt~~~~knr~~~~lr   47 (47)
T d1gv2a2           1 KTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMR   47 (47)
T ss_dssp             CCCCCHHHHHHHHHHHHHHSSCHHHHHTTCTTCCHHHHHHHHHHHTC
T ss_pred             CCCCCHHHHHHHHHHHHHHhhHHHHHHhHcCCCCHHHHHHHHHHHcC
Confidence            57999999999999999999999999999999999999999999874
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure