Citrus Sinensis ID: 034588

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MGVTKEKVESTLTSKLNPSHLEVIDTSGGCGAKFEIEIVSEQFEGKRLLARHRLVNAALEEEMKQIHALSIKKAMTPEQWKQQQESNAAA
ccccHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccc
*****EKVESTLTSKLNPSHLEVIDTSGGCGAKFEIEIVSEQFEGKRLLARHRLVNAALEEEMKQIHALSIKKAMT**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVTKEKVESTLTSKLNPSHLEVIDTSGGCGAKFEIEIVSEQFEGKRLLARHRLVNAALEEEMKQIHALSIKKAMTPEQWKQQQESNAAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BolA Plays an important role in general stress response (heat shock, acidic stress, oxidative stress, carbon-starvation stress and osmotic shock). Involved in morphogenetic pathway. Has a role in the induction of the expression of dacA (PBP5), dacC (PBP6) and ampC.probableP0ABE4
BolA-like protein 2 probableQ9H3K6
BolA-like protein 2 probableQ8BGS2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V9J, chain A
Confidence level:very confident
Coverage over the Query: 1-85
View the alignment between query and template
View the model in PyMOL