Citrus Sinensis ID: 034609

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MGASRGPRLSGLQKQVLSLYRGFLRAARCKSAADRRQIESIVSAEFRRNSNQVDRKNFLYIEYLLRRGKKQLEQLQSPNTESLSQTKQS
ccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccc
************QKQVLSLYRGFLRAARC******RQIESIVSAEFRRNSNQVDRKNFLYIEYLLRRGKKQLEQLQSP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGASRGPRLSGLQKQVLSLYRGFLRAARCKSAADRRQIESIVSAEFRRNSNQVDRKNFLYIEYLLRRGKKQLEQLQSPNTESLSQTKQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Succinate dehydrogenase assembly factor 1 homolog, mitochondrial Plays an essential role in succinate dehydrogenase complex (SDH) assembly, a complex involved in complex II of the mitochondrial electron transport chain. Probably acts by participating in mitochondrial biosynthesis of iron-sulfur centers for complex II.probableQ9US02

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted