Citrus Sinensis ID: 034713


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MTDFKFQFCLVLAKVYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHcc
*TDFKFQFCLVLAKVYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSW***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDFKFQFCLVLAKVYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMFSENKREYNRRVREIVEQSWTAD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 1 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.probableP25865
Ubiquitin-conjugating enzyme E2 2 Catalyzes the covalent attachment of ubiquitin to other proteins.probableQ553F3
Ubiquitin-conjugating enzyme E2 2 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.probableP42745

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AAK, chain A
Confidence level:very confident
Coverage over the Query: 1-84
View the alignment between query and template
View the model in PyMOL