Citrus Sinensis ID: 034823


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MAKSVASITTAVALIFAFFILFASFEMPVAEAKQCSKRAQKWTGPCIKTGSCRNHCRKREGAVDGACHYDFPGFACFCYYNC
cHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccCEEECccccccHHHHHcccccccccccccccccEEEEEccc
******SITTAVALIFAFFILFASFEMPVAEAKQCSKRAQKWTGPCIKTGSCRNHCRKREGAVDGACHYDFPGFACFCYYNC
xxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSVASITTAVALIFAFFILFASFEMPVAEAKQCSKRAQKWTGPCIKTGSCRNHCRKREGAVDGACHYDFPGFACFCYYNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Defensin-like protein 19 Confers broad-spectrum resistance to pathogens.probableP82787

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BK8, chain A
Confidence level:very confident
Coverage over the Query: 34-82
View the alignment between query and template
View the model in PyMOL