Citrus Sinensis ID: 034866


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MTSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGILFIFLNFVSFQY
cccccEEEEEEEEcccccccEEEEEccccccHHHHHHHHHHHccccccCEEEEEcccccccccccccEEEEEEEEEEEEc
******V***VTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGILFIFLNFVSFQY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGILFIFLNFVSFQY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-fold modifier 1 Ubiquitin-like modifier protein which binds to a number of as yet unidentified target proteins.confidentQ94DM8
Ubiquitin-fold modifier 1 Ubiquitin-like modifier protein which binds to a number of as yet unidentified target proteins.probableB5E0K3
Ubiquitin-fold modifier 1 Ubiquitin-like modifier protein which binds to a number of target proteins, such as DDRGK1.probableQ5R4N5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J0G, chain A
Confidence level:very confident
Coverage over the Query: 2-75
View the alignment between query and template
View the model in PyMOL