Citrus Sinensis ID: 034866
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 80 | ||||||
| 356552829 | 94 | PREDICTED: ubiquitin-fold modifier 1-lik | 0.887 | 0.755 | 0.915 | 2e-28 | |
| 356509448 | 88 | PREDICTED: ubiquitin-fold modifier 1-lik | 0.887 | 0.806 | 0.901 | 7e-28 | |
| 225459477 | 97 | PREDICTED: ubiquitin-fold modifier 1 [Vi | 0.837 | 0.690 | 0.940 | 1e-27 | |
| 255557781 | 92 | Ubiquitin-fold modifier 1 precursor, put | 0.837 | 0.728 | 0.940 | 2e-27 | |
| 449445140 | 90 | PREDICTED: ubiquitin-fold modifier 1-lik | 0.837 | 0.744 | 0.940 | 2e-27 | |
| 357488997 | 95 | Ubiquitin-fold modifier [Medicago trunca | 0.837 | 0.705 | 0.940 | 2e-27 | |
| 15217447 | 93 | ubiquitin-fold modifier 1 [Arabidopsis t | 0.887 | 0.763 | 0.873 | 2e-27 | |
| 297839629 | 94 | hypothetical protein ARALYDRAFT_895660 [ | 0.875 | 0.744 | 0.885 | 4e-27 | |
| 224063132 | 97 | predicted protein [Populus trichocarpa] | 0.825 | 0.680 | 0.939 | 7e-27 | |
| 168052114 | 95 | predicted protein [Physcomitrella patens | 0.862 | 0.726 | 0.884 | 1e-26 |
| >gi|356552829|ref|XP_003544765.1| PREDICTED: ubiquitin-fold modifier 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 129 bits (324), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 65/71 (91%), Positives = 67/71 (94%)
Query: 1 MTSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGI 60
M S GKVSFKVTLTSDPKLPFKVFSVPEAAPFT VLKFAAEEFKVPPQTSAIITNDGVGI
Sbjct: 1 MASGGKVSFKVTLTSDPKLPFKVFSVPEAAPFTAVLKFAAEEFKVPPQTSAIITNDGVGI 60
Query: 61 NPQQSAGILFI 71
NPQQSAG +F+
Sbjct: 61 NPQQSAGNVFL 71
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356509448|ref|XP_003523461.1| PREDICTED: ubiquitin-fold modifier 1-like [Glycine max] gi|356515854|ref|XP_003526612.1| PREDICTED: ubiquitin-fold modifier 1 [Glycine max] gi|255627345|gb|ACU14017.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225459477|ref|XP_002285835.1| PREDICTED: ubiquitin-fold modifier 1 [Vitis vinifera] gi|302141861|emb|CBI19064.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255557781|ref|XP_002519920.1| Ubiquitin-fold modifier 1 precursor, putative [Ricinus communis] gi|223540966|gb|EEF42524.1| Ubiquitin-fold modifier 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449445140|ref|XP_004140331.1| PREDICTED: ubiquitin-fold modifier 1-like [Cucumis sativus] gi|449527113|ref|XP_004170557.1| PREDICTED: ubiquitin-fold modifier 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357488997|ref|XP_003614786.1| Ubiquitin-fold modifier [Medicago truncatula] gi|355516121|gb|AES97744.1| Ubiquitin-fold modifier [Medicago truncatula] gi|388495206|gb|AFK35669.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|15217447|ref|NP_177894.1| ubiquitin-fold modifier 1 [Arabidopsis thaliana] gi|20140765|sp|Q9CA23.1|UFM1_ARATH RecName: Full=Ubiquitin-fold modifier 1; Flags: Precursor gi|12323301|gb|AAG51633.1|AC012193_15 unknown protein; 14107-15252 [Arabidopsis thaliana] gi|20260380|gb|AAM13088.1| unknown protein [Arabidopsis thaliana] gi|23197778|gb|AAN15416.1| unknown protein [Arabidopsis thaliana] gi|332197891|gb|AEE36012.1| ubiquitin-fold modifier 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297839629|ref|XP_002887696.1| hypothetical protein ARALYDRAFT_895660 [Arabidopsis lyrata subsp. lyrata] gi|297333537|gb|EFH63955.1| hypothetical protein ARALYDRAFT_895660 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224063132|ref|XP_002301006.1| predicted protein [Populus trichocarpa] gi|118484173|gb|ABK93968.1| unknown [Populus trichocarpa] gi|118485033|gb|ABK94381.1| unknown [Populus trichocarpa] gi|222842732|gb|EEE80279.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|168052114|ref|XP_001778496.1| predicted protein [Physcomitrella patens subsp. patens] gi|162670094|gb|EDQ56669.1| predicted protein [Physcomitrella patens subsp. patens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 80 | ||||||
| TAIR|locus:2203246 | 93 | CCP2 "AT1G77710" [Arabidopsis | 0.887 | 0.763 | 0.873 | 1.2e-28 | |
| UNIPROTKB|Q2KJG2 | 85 | UFM1 "Ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 1.8e-23 | |
| UNIPROTKB|F1Q2H2 | 84 | UFM1 "Uncharacterized protein" | 0.825 | 0.785 | 0.772 | 1.8e-23 | |
| UNIPROTKB|P61960 | 85 | UFM1 "Ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 1.8e-23 | |
| UNIPROTKB|Q4R4I2 | 85 | UFM1 "Ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 1.8e-23 | |
| UNIPROTKB|Q5R4N5 | 85 | UFM1 "Ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 1.8e-23 | |
| MGI|MGI:1915140 | 85 | Ufm1 "ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 1.8e-23 | |
| RGD|1304890 | 85 | Ufm1 "ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 1.8e-23 | |
| UNIPROTKB|F1P4P0 | 84 | UFM1 "Ubiquitin-fold modifier | 0.825 | 0.785 | 0.772 | 2.9e-23 | |
| UNIPROTKB|Q5ZMK7 | 85 | UFM1 "Ubiquitin-fold modifier | 0.825 | 0.776 | 0.772 | 2.9e-23 |
| TAIR|locus:2203246 CCP2 "AT1G77710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 319 (117.4 bits), Expect = 1.2e-28, P = 1.2e-28
Identities = 62/71 (87%), Positives = 66/71 (92%)
Query: 1 MTSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGI 60
M + GKVSFKVTLTSDPKLPFKVFSVPE APFT VLKFAAEEFKVPPQTSAIITNDG+GI
Sbjct: 1 MATGGKVSFKVTLTSDPKLPFKVFSVPEGAPFTAVLKFAAEEFKVPPQTSAIITNDGIGI 60
Query: 61 NPQQSAGILFI 71
NPQQSAG +F+
Sbjct: 61 NPQQSAGNVFL 71
|
|
| UNIPROTKB|Q2KJG2 UFM1 "Ubiquitin-fold modifier 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2H2 UFM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61960 UFM1 "Ubiquitin-fold modifier 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R4I2 UFM1 "Ubiquitin-fold modifier 1" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R4N5 UFM1 "Ubiquitin-fold modifier 1" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915140 Ufm1 "ubiquitin-fold modifier 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1304890 Ufm1 "ubiquitin-fold modifier 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4P0 UFM1 "Ubiquitin-fold modifier 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZMK7 UFM1 "Ubiquitin-fold modifier 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 80 | |||
| cd01766 | 82 | cd01766, Ufm1, Urm1-like ubiquitin domain | 1e-34 | |
| pfam03671 | 76 | pfam03671, Ufm1, Ubiquitin fold modifier 1 protein | 4e-33 |
| >gnl|CDD|176361 cd01766, Ufm1, Urm1-like ubiquitin domain | Back alignment and domain information |
|---|
Score = 112 bits (282), Expect = 1e-34
Identities = 52/67 (77%), Positives = 59/67 (88%)
Query: 5 GKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQ 64
KV+FK+TLTSDPKLPFKV SVPE+ PFT VLKFAAEEFKVP TSAIITNDG+GINP Q
Sbjct: 1 SKVTFKITLTSDPKLPFKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQ 60
Query: 65 SAGILFI 71
+AG +F+
Sbjct: 61 TAGNVFL 67
|
Ufm1 (ubiquitin-fold modifier 1) is a post-translational UBL (ubiquitin-like) modifier with a tertiary structure similar to that of ubiquitin. Ufm1 is initially expressed as a precursor which undergoes C-terminal cleavage to expose a conserved glycine residue that is required for the conjugation reactions involving Ufm1. Length = 82 |
| >gnl|CDD|202722 pfam03671, Ufm1, Ubiquitin fold modifier 1 protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| cd01766 | 82 | Ufm1 Urm1-like ubiquitin domain. Ufm1 (ubiquitin-f | 100.0 | |
| PF03671 | 76 | Ufm1: Ubiquitin fold modifier 1 protein; InterPro: | 100.0 | |
| KOG3483 | 94 | consensus Uncharacterized conserved protein [Funct | 100.0 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 96.21 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 94.44 | |
| cd01612 | 87 | APG12_C Ubiquitin-like domain of APG12. APG12_C Th | 92.55 | |
| PF11834 | 69 | DUF3354: Domain of unknown function (DUF3354); Int | 90.13 | |
| cd01768 | 87 | RA RA (Ras-associating) ubiquitin domain. The RA ( | 89.4 | |
| PF04083 | 63 | Abhydro_lipase: Partial alpha/beta-hydrolase lipas | 88.1 | |
| smart00314 | 90 | RA Ras association (RalGDS/AF-6) domain. RasGTP ef | 87.73 | |
| PF04110 | 87 | APG12: Ubiquitin-like autophagy protein Apg12 ; In | 84.8 | |
| PF00788 | 93 | RA: Ras association (RalGDS/AF-6) domain; InterPro | 83.24 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 81.45 |
| >cd01766 Ufm1 Urm1-like ubiquitin domain | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-55 Score=290.81 Aligned_cols=71 Identities=73% Similarity=1.099 Sum_probs=69.7
Q ss_pred ceEEEEEEecCCCCCceeEEeeCCCCchhhhhhhhhhhhCCCCcceeEEecCCcccCcccccceeeeeeee
Q 034866 5 GKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGILFIFLNF 75 (80)
Q Consensus 5 ~KVtFKItltsdpklP~kvlsVPE~aPFtAVlkfaAEeFkv~~~TsAiITndGiGINP~QtAG~VFlkhgf 75 (80)
+||||||||||||||||||+||||+|||||||||||||||||++|||||||||+||||+|||||||||||=
T Consensus 1 ~KVtFkitltSdp~lpfkvlsVpE~aPftAvlkfaAEeFkv~~~TsAiiTndGvGINP~qtAGnvflkhgs 71 (82)
T cd01766 1 SKVTFKITLTSDPKLPFKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGS 71 (82)
T ss_pred CceEEEEEecCCCCCcceEEeccccCchHHHHHHHHHhcCCCccceeEEecCccccChhhcccceeeecCC
Confidence 59999999999999999999999999999999999999999999999999999999999999999999993
|
Ufm1 (ubiquitin-fold modifier 1) is a post-translational UBL (ubiquitin-like) modifier with a tertiary structure similar to that of ubiquitin. Ufm1 is initially expressed as a precursor which undergoes C-terminal cleavage to expose a conserved glycine residue that is required for the conjugation reactions involving Ufm1. |
| >PF03671 Ufm1: Ubiquitin fold modifier 1 protein; InterPro: IPR005375 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >KOG3483 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd01612 APG12_C Ubiquitin-like domain of APG12 | Back alignment and domain information |
|---|
| >PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement | Back alignment and domain information |
|---|
| >cd01768 RA RA (Ras-associating) ubiquitin domain | Back alignment and domain information |
|---|
| >PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function | Back alignment and domain information |
|---|
| >smart00314 RA Ras association (RalGDS/AF-6) domain | Back alignment and domain information |
|---|
| >PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 80 | ||||
| 1wxs_A | 90 | Solution Structure Of Ufm1, A Ubiquitin-Fold Modifi | 4e-25 | ||
| 1j0g_A | 92 | Solution Structure Of Mouse Hypothetical 9.1 Kda Pr | 5e-25 | ||
| 1l7y_A | 94 | Solution Nmr Structure Of C. Elegans Protein Zk652. | 5e-25 |
| >pdb|1WXS|A Chain A, Solution Structure Of Ufm1, A Ubiquitin-Fold Modifier Length = 90 | Back alignment and structure |
|
| >pdb|1J0G|A Chain A, Solution Structure Of Mouse Hypothetical 9.1 Kda Protein, A Ubiquitin-Like Fold Length = 92 | Back alignment and structure |
| >pdb|1L7Y|A Chain A, Solution Nmr Structure Of C. Elegans Protein Zk652.3. Northeast Structural Genomics Consortium Target Wr41 Length = 94 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 80 | |||
| 1j0g_A | 92 | Hypothetical protein 1810045K17; ubiquitin-like fo | 7e-32 |
| >1j0g_A Hypothetical protein 1810045K17; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.6 PDB: 1wxs_A 1l7y_A Length = 92 | Back alignment and structure |
|---|
Score = 105 bits (263), Expect = 7e-32
Identities = 51/70 (72%), Positives = 60/70 (85%)
Query: 2 TSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGIN 61
+ KVSFK+TLTSDP+LP+KV SVPE+ PFT VLKFAAEEFKVP TSAIITNDG+GIN
Sbjct: 6 ATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGIN 65
Query: 62 PQQSAGILFI 71
P Q+AG +F+
Sbjct: 66 PAQTAGNVFL 75
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| 1j0g_A | 92 | Hypothetical protein 1810045K17; ubiquitin-like fo | 100.0 | |
| 4gdk_A | 91 | Ubiquitin-like protein ATG12; protein-protein conj | 94.76 | |
| 1wz3_A | 96 | Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla | 92.06 | |
| 3w1s_C | 91 | Ubiquitin-like protein ATG12; ubiquitin fold, E3-l | 88.38 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 85.22 | |
| 3gyg_A | 289 | NTD biosynthesis operon putative hydrolase NTDB; P | 83.75 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 83.41 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 82.06 |
| >1j0g_A Hypothetical protein 1810045K17; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.6 PDB: 1wxs_A 1l7y_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-55 Score=295.48 Aligned_cols=74 Identities=69% Similarity=1.048 Sum_probs=71.7
Q ss_pred CCCceEEEEEEecCCCCCceeEEeeCCCCchhhhhhhhhhhhCCCCcceeEEecCCcccCcccccceeeeeeee
Q 034866 2 TSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGILFIFLNF 75 (80)
Q Consensus 2 ~~~~KVtFKItltsdpklP~kvlsVPE~aPFtAVlkfaAEeFkv~~~TsAiITndGiGINP~QtAG~VFlkhgf 75 (80)
++++|||||||||||||||||||||||+||||||||||||||+|||+|||||||||+||||||||||||||||=
T Consensus 6 ~~~~kVtFkItltSdpklpfkvlsVPE~~PftAVlkfaaEeF~vp~~TsAiiT~dGiGInP~QtAGnvFlKhGs 79 (92)
T 1j0g_A 6 ATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGS 79 (92)
T ss_dssp CCSCEEEEEEEETTSTTCCEEEEEEETTSBHHHHHHHHHHHTTCCSSSEEEECTTSCCCCCSSBHHHHHHHTCS
T ss_pred cCCceEEEEEEEccCCCCCceEEecCccCchHHHHHHHHHHcCCCccceEEEecCCcccChhhccchhhhhcCc
Confidence 35799999999999999999999999999999999999999999999999999999999999999999999993
|
| >4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A | Back alignment and structure |
|---|
| >1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 | Back alignment and structure |
|---|
| >3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 80 | ||||
| d1j0ga_ | 92 | d.15.1.6 (A:) Hypothetical protein 1810045k17 {Mou | 6e-38 |
| >d1j0ga_ d.15.1.6 (A:) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: BM-002-like domain: Hypothetical protein 1810045k17 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 119 bits (300), Expect = 6e-38
Identities = 51/70 (72%), Positives = 60/70 (85%)
Query: 2 TSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGIN 61
+ KVSFK+TLTSDP+LP+KV SVPE+ PFT VLKFAAEEFKVP TSAIITNDG+GIN
Sbjct: 6 ATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGIN 65
Query: 62 PQQSAGILFI 71
P Q+AG +F+
Sbjct: 66 PAQTAGNVFL 75
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 80 | |||
| d1j0ga_ | 92 | Hypothetical protein 1810045k17 {Mouse (Mus muscul | 100.0 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 91.67 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 89.05 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 87.97 | |
| d2g80a1 | 225 | Protein UTR4 {Baker's yeast (Saccharomyces cerevis | 85.58 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 84.9 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 83.55 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 82.9 | |
| d2c4na1 | 250 | NagD {Escherichia coli [TaxId: 562]} | 82.54 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 82.41 | |
| d1wvia_ | 253 | Putative phosphatase SMU.1415c {Streptococcus muta | 80.67 |
| >d1j0ga_ d.15.1.6 (A:) Hypothetical protein 1810045k17 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-Grasp (ubiquitin-like) superfamily: Ubiquitin-like family: BM-002-like domain: Hypothetical protein 1810045k17 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=4.1e-55 Score=293.97 Aligned_cols=75 Identities=68% Similarity=1.031 Sum_probs=72.8
Q ss_pred CCCCceEEEEEEecCCCCCceeEEeeCCCCchhhhhhhhhhhhCCCCcceeEEecCCcccCcccccceeeeeeee
Q 034866 1 MTSRGKVSFKVTLTSDPKLPFKVFSVPEAAPFTVVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGILFIFLNF 75 (80)
Q Consensus 1 ~~~~~KVtFKItltsdpklP~kvlsVPE~aPFtAVlkfaAEeFkv~~~TsAiITndGiGINP~QtAG~VFlkhgf 75 (80)
+++++|||||||||||||||||||||||++||||||||||||||||++|||||||||+||||+|||||||||||=
T Consensus 5 ~~~~~kvtfkitltSdp~lpfkvlsVpE~aPftAVlkfaAEeFkV~~~TSAiITndGvGINP~QtAg~vFlKhGs 79 (92)
T d1j0ga_ 5 AATMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQTAGNVFLKHGS 79 (92)
T ss_dssp SCCSCEEEEEEEETTSTTCCEEEEEEETTSBHHHHHHHHHHHTTCCSSSEEEECTTSCCCCCSSBHHHHHHHTCS
T ss_pred ccccceEEEEEEEccCCCCccEEEecCccCchHHHHHHHHHHcCCCccceeEEecCccccChhhccchhhhhcCc
Confidence 357899999999999999999999999999999999999999999999999999999999999999999999993
|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|