Citrus Sinensis ID: 034893


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MELADRVVGFLLSFISLSIFTYYTFWVIILPFVDTDHFIHQYFLPQEYAIIIPVFAGVVLLCFLCIFIGFVILKSKKKKA
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
***ADRVVGFLLSFISLSIFTYYTFWVIILPFVDTDHFIHQYFLPQEYAIIIPVFAGVVLLCFLCIFIGFVILKS*****
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELADRVVGFLLSFISLSIFTYYTFWVIILPFVDTDHFIHQYFLPQEYAIIIPVFAGVVLLCFLCIFIGFVILKSKKKKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichol phosphate-mannose biosynthesis regulatory protein Regulates the biosynthesis of dolichol phosphate-mannose. Essential for the ER localization and stable expression of DPM1.probableQ2KIN1
Dolichol phosphate-mannose biosynthesis regulatory protein Regulates the biosynthesis of dolichol phosphate-mannose. Essential for the ER localization and stable expression of DPM1.probableQ9Z1P1
Dolichol phosphate-mannose biosynthesis regulatory protein Regulates the biosynthesis of dolichol phosphate-mannose. Essential for the ER localization and stable expression of DPM1.probableQ9Z324

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted