Score = 61.6 bits (148), Expect = 1e-09, Method: Compositional matrix adjust.
Identities = 28/70 (40%), Positives = 46/70 (65%)
Query: 11 LLSFISLSIFTYYTFWVIILPFVDTDHFIHQYFLPQEYAIIIPVFAGVVLLCFLCIFIGF 70
++ +IS + F YYT WV+I+PFVD + + FL +E+AI IPV + +C + F+
Sbjct: 1 MIVYISTAAFLYYTIWVLIMPFVDNMNISQKLFLDREWAITIPVAVMLFGICLIGTFVSL 60
Query: 71 VILKSKKKKA 80
+++KS KKK+
Sbjct: 61 LMIKSSKKKS 70
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.340 0.154 0.489
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,426,040
Number of Sequences: 539616
Number of extensions: 935059
Number of successful extensions: 3397
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 3389
Number of HSP's gapped (non-prelim): 14
length of query: 80
length of database: 191,569,459
effective HSP length: 51
effective length of query: 29
effective length of database: 164,049,043
effective search space: 4757422247
effective search space used: 4757422247
T: 11
A: 40
X1: 15 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.8 bits)
S2: 55 (25.8 bits)
Regulates the biosynthesis of dolichol phosphate-mannose. Essential for the ER localization and stable expression of dpm1.
This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins. Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2. Length = 80
>PF07297 DPM2: Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2); InterPro: IPR009914 This family consists of several eukaryotic dolichol phosphate-mannose biosynthesis regulatory (DPM2) proteins
Biosynthesis of glycosylphosphatidylinositol and N-glycan precursor is dependent upon a mannosyl donor, dolichol phosphate-mannose (DPM). DPM2, an 84 amino acid membrane protein expressed in the endoplasmic reticulum (ER), makes a complex with DPM1 that is essential for the ER localisation and stable expression of DPM1. Moreover, DPM2 enhances binding of dolichol phosphate, a substrate of DPM synthase. Biosynthesis of DPM in mammalian cells is regulated by DPM2 [].; GO: 0009059 macromolecule biosynthetic process, 0030176 integral to endoplasmic reticulum membrane
>KOG3488 consensus Dolichol phosphate-mannose regulatory protein (DPM2) [Posttranslational modification, protein turnover, chaperones]
>PF10510 PIG-S: Phosphatidylinositol-glycan biosynthesis class S protein; InterPro: IPR019540 Phosphatidylinositol-glycan biosynthesis class S protein (PIG-S) is one of several key, core components of the glycosylphosphatidylinositol (GPI) trans-amidase complex that mediates GPI anchoring in the endoplasmic reticulum
Anchoring occurs when a protein's C-terminal GPI attachment signal peptide is replaced with a pre-assembled GPI []. Mammalian GPI transamidase consists of at least five components: Gaa1, Gpi8, PIG-S, PIG-T, and PIG-U, all five of which are required for its function. It is possible that Gaa1, Gpi8, PIG-S, and PIG-T form a tightly associated core that is only weakly associated with PIG-U. The exact function of PIG-S is unclear [].