Citrus Sinensis ID: 034999

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
MERSVRLFSTVLLVLLLLASEMGLRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC
cccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccCECccccccccHHHHccccccccccccccccEEECccc
****VRLFSTVLLVLLLLASEMGLRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC
xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERSVRLFSTVLLVLLLLASEMGLRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Defensin-like protein 2 Confers broad-spectrum resistance to pathogens.probableQ39182
Defensin-like protein May be involved in the defense of the pistil against pathogen infection.probableQ40901
Defensin-like protein probableA3FPF2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LR3, chain A
Confidence level:very confident
Coverage over the Query: 30-76
View the alignment between query and template
View the model in PyMOL