Citrus Sinensis ID: 035002
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| 255567929 | 452 | cytochrome P450, putative [Ricinus commu | 0.947 | 0.159 | 0.722 | 6e-27 | |
| 449448284 | 497 | PREDICTED: isoflavone 2'-hydroxylase-lik | 0.947 | 0.144 | 0.694 | 2e-26 | |
| 449513121 | 497 | PREDICTED: isoflavone 2'-hydroxylase-lik | 0.947 | 0.144 | 0.694 | 2e-26 | |
| 297591647 | 506 | cytochrome P450 [Sesamum schinzianum] | 0.947 | 0.142 | 0.694 | 4e-26 | |
| 449513117 | 498 | PREDICTED: isoflavone 2'-hydroxylase-lik | 0.947 | 0.144 | 0.680 | 2e-25 | |
| 81157970 | 506 | cytochrome P450 [Sesamum radiatum] | 0.947 | 0.142 | 0.680 | 2e-25 | |
| 449448488 | 510 | PREDICTED: cytochrome P450 81D1-like [Cu | 0.960 | 0.143 | 0.671 | 2e-25 | |
| 449487433 | 507 | PREDICTED: isoflavone 2'-hydroxylase-lik | 0.947 | 0.142 | 0.694 | 4e-25 | |
| 449445804 | 507 | PREDICTED: isoflavone 2'-hydroxylase-lik | 0.947 | 0.142 | 0.694 | 4e-25 | |
| 21554381 | 494 | cytochrome P450-like protein [Arabidopsi | 0.934 | 0.143 | 0.694 | 6e-25 |
| >gi|255567929|ref|XP_002524942.1| cytochrome P450, putative [Ricinus communis] gi|223535777|gb|EEF37439.1| cytochrome P450, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 124 bits (312), Expect = 6e-27, Method: Composition-based stats.
Identities = 52/72 (72%), Positives = 62/72 (86%)
Query: 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKIDMTEGKGITMPKAEALEV 60
+MPFGLGRR+CPG GLAQR+VGL LGSLIQCFEWER+ +++DM EGKG+T+PKAE LE
Sbjct: 377 LMPFGLGRRSCPGAGLAQRVVGLALGSLIQCFEWERVSGEEVDMAEGKGVTLPKAEPLEA 436
Query: 61 MCKPRPIINKIL 72
MCK RPI+ IL
Sbjct: 437 MCKARPIMKNIL 448
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449448284|ref|XP_004141896.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449513121|ref|XP_004164236.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297591647|dbj|BAJ09068.1| cytochrome P450 [Sesamum schinzianum] | Back alignment and taxonomy information |
|---|
| >gi|449513117|ref|XP_004164235.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|81157970|dbj|BAE48235.1| cytochrome P450 [Sesamum radiatum] | Back alignment and taxonomy information |
|---|
| >gi|449448488|ref|XP_004141998.1| PREDICTED: cytochrome P450 81D1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449487433|ref|XP_004157624.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449445804|ref|XP_004140662.1| PREDICTED: isoflavone 2'-hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|21554381|gb|AAM63488.1| cytochrome P450-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 76 | ||||||
| TAIR|locus:2126332 | 499 | CYP81D2 ""cytochrome P450, fam | 1.0 | 0.152 | 0.710 | 4.3e-25 | |
| TAIR|locus:2126342 | 497 | CYP81D8 ""cytochrome P450, fam | 0.921 | 0.140 | 0.704 | 9.2e-24 | |
| TAIR|locus:2115050 | 500 | CYP81D3 ""cytochrome P450, fam | 0.947 | 0.144 | 0.684 | 2e-22 | |
| TAIR|locus:2028972 | 386 | AT1G66540 [Arabidopsis thalian | 0.934 | 0.183 | 0.661 | 3.6e-22 | |
| TAIR|locus:2183597 | 502 | CYP81D1 "cytochrome P450, fami | 0.947 | 0.143 | 0.652 | 7.2e-22 | |
| TAIR|locus:2115135 | 495 | CYP81D5 ""cytochrome P450, fam | 0.947 | 0.145 | 0.638 | 3.1e-21 | |
| TAIR|locus:2098418 | 509 | CYP81D11 "cytochrome P450, fam | 0.947 | 0.141 | 0.643 | 4.4e-21 | |
| TAIR|locus:2158222 | 507 | CYP81G1 ""cytochrome P450, fam | 0.947 | 0.142 | 0.611 | 3.3e-20 | |
| TAIR|locus:2115075 | 492 | CYP81D4 ""cytochrome P450, fam | 0.947 | 0.146 | 0.597 | 3.8e-20 | |
| TAIR|locus:2114965 | 518 | CYP81H1 ""cytochrome P450, fam | 0.986 | 0.144 | 0.605 | 5.8e-20 |
| TAIR|locus:2126332 CYP81D2 ""cytochrome P450, family 81, subfamily D, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 290 (107.1 bits), Expect = 4.3e-25, P = 4.3e-25
Identities = 54/76 (71%), Positives = 63/76 (82%)
Query: 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKIDMTEGKGITMPKAEALEV 60
+MPFGLGRRACPG GLAQRLV L+LGSLIQCFEWERIG +++DMTEG G+TMPKA LE
Sbjct: 424 LMPFGLGRRACPGSGLAQRLVTLSLGSLIQCFEWERIGEEEVDMTEGPGLTMPKARPLEA 483
Query: 61 MCKPRPIINKILLGST 76
MC+ R + KIL S+
Sbjct: 484 MCRARDFVGKILPDSS 499
|
|
| TAIR|locus:2126342 CYP81D8 ""cytochrome P450, family 81, subfamily D, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115050 CYP81D3 ""cytochrome P450, family 81, subfamily D, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2028972 AT1G66540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2183597 CYP81D1 "cytochrome P450, family 81, subfamily D, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115135 CYP81D5 ""cytochrome P450, family 81, subfamily D, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098418 CYP81D11 "cytochrome P450, family 81, subfamily D, polypeptide 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158222 CYP81G1 ""cytochrome P450, family 81, subfamily G, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2115075 CYP81D4 ""cytochrome P450, family 81, subfamily D, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2114965 CYP81H1 ""cytochrome P450, family 81, subfamily H, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| CYP81D2 | CYP81D2; electron carrier/ heme binding / iron ion binding / monooxygenase/ oxygen binding; member of CYP81D (499 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| CYP71B36 | • | • | • | • | 0.952 | ||||||
| CYP71B30P | • | • | • | • | 0.914 | ||||||
| CYP78A7 | • | • | • | 0.908 | |||||||
| CYP78A8 | • | • | • | 0.908 | |||||||
| CYP71B31 | • | • | • | 0.908 | |||||||
| PAD3 | • | • | • | 0.907 | |||||||
| T30G6.3 | • | • | • | • | 0.907 | ||||||
| CYP77A4 | • | • | • | 0.907 | |||||||
| CYP71B28 | • | • | • | 0.907 | |||||||
| CYP71B29 | • | • | • | 0.907 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 76 | |||
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 3e-14 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 2e-12 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 2e-12 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 9e-11 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 4e-10 | |
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 1e-09 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 2e-09 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 2e-08 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 1e-06 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 9e-06 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 2e-04 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 6e-04 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 0.002 |
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
Score = 65.2 bits (159), Expect = 3e-14
Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 3/68 (4%)
Query: 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEW---ERIGCQKIDMTEGKGITMPKAEA 57
++PF G+R CPG L +V + L L CF+W + + + ID E G+TMPKA+
Sbjct: 440 ILPFSAGKRKCPGAPLGVTMVLMALARLFHCFDWSPPDGLRPEDIDTQEVYGMTMPKAKP 499
Query: 58 LEVMCKPR 65
L + PR
Sbjct: 500 LRAVATPR 507
|
Length = 514 |
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| KOG0158 | 499 | consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf | 99.71 | |
| KOG0157 | 497 | consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami | 99.69 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 99.67 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 99.66 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 99.65 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 99.64 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 99.64 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 99.62 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 99.62 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.61 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 99.6 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 99.6 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 99.6 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 99.59 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 99.59 | |
| PLN02655 | 466 | ent-kaurene oxidase | 99.59 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 99.58 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 99.58 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 99.58 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 99.58 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 99.58 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 99.56 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 99.55 | |
| KOG0159 | 519 | consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 | 99.55 | |
| KOG0684 | 486 | consensus Cytochrome P450 [Secondary metabolites b | 99.53 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 99.53 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 99.52 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 99.52 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 99.52 | |
| KOG0156 | 489 | consensus Cytochrome P450 CYP2 subfamily [Secondar | 99.49 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 99.27 | |
| PLN02648 | 480 | allene oxide synthase | 99.05 | |
| PF09201 | 148 | SRX: SRX; InterPro: IPR015284 The signal recogniti | 83.72 |
| >KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
Probab=99.71 E-value=3e-17 Score=101.66 Aligned_cols=66 Identities=30% Similarity=0.540 Sum_probs=54.2
Q ss_pred CcccCCCccCCCChhHHHHHHHHHHHHHhhhceeeeccCcccccc-cccceeccCCCceeEEEEeCc
Q 035002 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKIDMT-EGKGITMPKAEALEVMCKPRP 66 (76)
Q Consensus 1 ~~pFg~G~r~C~G~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~r~ 66 (76)
|+|||.|+|.|+|.+||++|+++.++.++++|+++..+....... ......+.|++++++++++|.
T Consensus 433 ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~~t~~~~~~~~~~~~l~pk~gi~Lkl~~r~ 499 (499)
T KOG0158|consen 433 YLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCPTTIIPLEGDPKGFTLSPKGGIWLKLEPRD 499 (499)
T ss_pred ccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCCcccCcccCCccceeeecCCceEEEEEeCC
Confidence 789999999999999999999999999999999998773222211 112677788889999999874
|
|
| >KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >PF09201 SRX: SRX; InterPro: IPR015284 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 76 | ||||
| 2hi4_A | 495 | Crystal Structure Of Human Microsomal P450 1a2 In C | 8e-04 |
| >pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 76 | |||
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 6e-20 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 5e-18 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 9e-15 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 2e-13 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 2e-12 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 2e-12 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 1e-09 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 9e-09 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 2e-08 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 5e-08 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 5e-08 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 9e-08 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 2e-07 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 1e-06 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 1e-06 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 2e-06 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 2e-06 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 3e-06 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 3e-06 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 7e-06 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 1e-05 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 8e-05 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-04 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 9e-04 |
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
Score = 80.4 bits (199), Expect = 6e-20
Identities = 13/68 (19%), Positives = 25/68 (36%), Gaps = 4/68 (5%)
Query: 2 MPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQK---IDMTEGKGI-TMPKAEA 57
+P+G CPG A + + +++ F+ E + G + A
Sbjct: 403 VPWGTEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGD 462
Query: 58 LEVMCKPR 65
LE+ + R
Sbjct: 463 LEIRYRIR 470
|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 99.73 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 99.73 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.71 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 99.69 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 99.68 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 99.66 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 99.66 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 99.65 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 99.65 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 99.64 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 99.64 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 99.63 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 99.63 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 99.62 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 99.62 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 99.62 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 99.62 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 99.61 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 99.6 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 99.6 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 99.6 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 99.59 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 99.58 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 99.57 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 99.57 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.55 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 99.53 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 99.53 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 99.53 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 99.52 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 99.52 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 99.52 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 99.51 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 99.51 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 99.51 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.51 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 99.5 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 99.5 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.49 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 99.49 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 99.48 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 99.48 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.47 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 99.47 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.47 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.47 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 99.47 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 99.46 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 99.45 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 99.44 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.43 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 99.43 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 99.43 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 99.43 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 99.42 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 99.42 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 99.42 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 99.41 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 99.41 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 99.41 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 99.41 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 99.4 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 99.39 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.39 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 99.38 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.37 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.37 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 99.36 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 99.36 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 99.36 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 99.32 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 99.3 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 99.3 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.26 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.24 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.19 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.15 |
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
Probab=99.73 E-value=3.1e-18 Score=103.24 Aligned_cols=66 Identities=29% Similarity=0.353 Sum_probs=51.4
Q ss_pred CcccCCCccCCCChhHHHHHHHHHHHHHhhhceeeeccCcccc-cccccceeccCCCceeEEEEeCcc
Q 035002 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKID-MTEGKGITMPKAEALEVMCKPRPI 67 (76)
Q Consensus 1 ~~pFg~G~r~C~G~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~r~~ 67 (76)
|+|||.|+|.|+|++||++|++++++.++++|++++.++...+ .....++...| .++++++++|.+
T Consensus 411 ~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P-~~~~v~~~pRs~ 477 (479)
T 3tbg_A 411 FLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSP-SPYELCAVPRHH 477 (479)
T ss_dssp CCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEE-CCCCBEEEEC--
T ss_pred eecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeecC-CCeEEEEEECCC
Confidence 6899999999999999999999999999999999987654322 22223444555 489999999975
|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 76 | ||||
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 2e-15 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 2e-14 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 4e-14 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 3e-13 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 6e-13 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 7e-13 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 5e-09 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 6e-09 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 2e-08 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 4e-08 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 1e-07 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 2e-07 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 2e-07 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 1e-06 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 1e-06 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 1e-06 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 2e-06 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 3e-06 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 6e-06 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 6e-06 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 1e-05 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.0 bits (162), Expect = 2e-15
Identities = 16/65 (24%), Positives = 28/65 (43%)
Query: 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKIDMTEGKGITMPKAEALEV 60
PFG G R C GM A + L L ++Q F ++ +I + G + + + +
Sbjct: 405 YTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVL 464
Query: 61 MCKPR 65
+ R
Sbjct: 465 KVESR 469
|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 76 | |||
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 99.76 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 99.73 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 99.72 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 99.68 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 99.67 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 99.64 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.59 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 99.59 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.58 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.57 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.56 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.53 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.52 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 99.51 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 99.47 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.46 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.46 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.44 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.39 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.36 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.34 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.76 E-value=7.5e-19 Score=103.94 Aligned_cols=67 Identities=24% Similarity=0.350 Sum_probs=57.2
Q ss_pred CcccCCCccCCCChhHHHHHHHHHHHHHhhhceeeeccCcccccccccceeccCCCceeEEEEeCcc
Q 035002 1 MMPFGLGRRACPGMGLAQRLVGLTLGSLIQCFEWERIGCQKIDMTEGKGITMPKAEALEVMCKPRPI 67 (76)
Q Consensus 1 ~~pFg~G~r~C~G~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~ 67 (76)
|+|||.|+|.|+|+++|.+|++++++.++++|||++.++...+........+.|+.++.+++++|+.
T Consensus 405 ~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R~~ 471 (472)
T d1tqna_ 405 YTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDG 471 (472)
T ss_dssp SCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEETTC
T ss_pred ecCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEECCC
Confidence 5899999999999999999999999999999999987765545544455566777899999999974
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|