Citrus Sinensis ID: 035056

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGTVSYSSCQFLCSMVLLE
cEEEEHHHHHHccEEEEEEEEEEEccccccEEEEEEEEECccccccEEEEEEEEccccCEEEccccEEEEEEEc
MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGTVSYSSCQFLCSMVLLE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGTVSYSSCQFLCSMVLLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein disulfide isomerase-like 5-4 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. May play a role in storage protein biogenesis.probableQ69SA9
Protein disulfide-isomerase 5-4 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.probableQ9T042

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted