Citrus Sinensis ID: 035056
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 74 | ||||||
| 224126339 | 484 | predicted protein [Populus trichocarpa] | 0.783 | 0.119 | 0.758 | 3e-18 | |
| 255563725 | 478 | thioredoxin domain-containing protein, p | 0.783 | 0.121 | 0.758 | 7e-18 | |
| 224117462 | 484 | predicted protein [Populus trichocarpa] | 0.783 | 0.119 | 0.741 | 2e-17 | |
| 388497088 | 457 | unknown [Medicago truncatula] | 0.783 | 0.126 | 0.741 | 2e-17 | |
| 357474735 | 477 | Endoplasmic reticulum-Golgi intermediate | 0.783 | 0.121 | 0.724 | 8e-17 | |
| 22328963 | 480 | protein PDI-like 5-4 [Arabidopsis thalia | 0.783 | 0.120 | 0.724 | 9e-17 | |
| 297803392 | 480 | hypothetical protein ARALYDRAFT_492089 [ | 0.783 | 0.120 | 0.724 | 9e-17 | |
| 356549839 | 480 | PREDICTED: protein disulfide-isomerase 5 | 0.783 | 0.120 | 0.706 | 9e-17 | |
| 238480964 | 532 | protein PDI-like 5-4 [Arabidopsis thalia | 0.783 | 0.109 | 0.724 | 1e-16 | |
| 115472445 | 485 | Os07g0524100 [Oryza sativa Japonica Grou | 0.783 | 0.119 | 0.706 | 2e-16 |
| >gi|224126339|ref|XP_002319814.1| predicted protein [Populus trichocarpa] gi|222858190|gb|EEE95737.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 95.9 bits (237), Expect = 3e-18, Method: Composition-based stats.
Identities = 44/58 (75%), Positives = 50/58 (86%)
Query: 1 MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGT 58
MV ELNNYLTV TST+VIVD S+DG+FLRIDFN+SFPSL CEFAS+DVS+VLGT
Sbjct: 38 MVFLFGMELNNYLTVNTSTSVIVDNSSDGEFLRIDFNLSFPSLSCEFASVDVSDVLGT 95
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255563725|ref|XP_002522864.1| thioredoxin domain-containing protein, putative [Ricinus communis] gi|223537948|gb|EEF39562.1| thioredoxin domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224117462|ref|XP_002317580.1| predicted protein [Populus trichocarpa] gi|222860645|gb|EEE98192.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388497088|gb|AFK36610.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357474735|ref|XP_003607653.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] gi|355508708|gb|AES89850.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|22328963|ref|NP_567765.2| protein PDI-like 5-4 [Arabidopsis thaliana] gi|75213708|sp|Q9T042.1|PDI54_ARATH RecName: Full=Protein disulfide-isomerase 5-4; Short=AtPDIL5-4; AltName: Full=Protein disulfide-isomerase 7; Short=PDI7; AltName: Full=Protein disulfide-isomerase 8-2; Short=AtPDIL8-2; Flags: Precursor gi|4490704|emb|CAB38838.1| putative protein [Arabidopsis thaliana] gi|7269561|emb|CAB79563.1| putative protein [Arabidopsis thaliana] gi|15450832|gb|AAK96687.1| putative protein [Arabidopsis thaliana] gi|20259836|gb|AAM13265.1| putative protein [Arabidopsis thaliana] gi|332659897|gb|AEE85297.1| protein PDI-like 5-4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297803392|ref|XP_002869580.1| hypothetical protein ARALYDRAFT_492089 [Arabidopsis lyrata subsp. lyrata] gi|297315416|gb|EFH45839.1| hypothetical protein ARALYDRAFT_492089 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356549839|ref|XP_003543298.1| PREDICTED: protein disulfide-isomerase 5-4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|238480964|ref|NP_680742.2| protein PDI-like 5-4 [Arabidopsis thaliana] gi|332659898|gb|AEE85298.1| protein PDI-like 5-4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|115472445|ref|NP_001059821.1| Os07g0524100 [Oryza sativa Japonica Group] gi|75118816|sp|Q69SA9.1|PDI54_ORYSJ RecName: Full=Protein disulfide isomerase-like 5-4; Short=OsPDIL5-4; AltName: Full=Protein disulfide isomerase-like 8-1; Short=OsPDIL8-1; Flags: Precursor gi|50508559|dbj|BAD30858.1| thioredoxin family-like protein [Oryza sativa Japonica Group] gi|113611357|dbj|BAF21735.1| Os07g0524100 [Oryza sativa Japonica Group] gi|215704615|dbj|BAG94243.1| unnamed protein product [Oryza sativa Japonica Group] gi|218199742|gb|EEC82169.1| hypothetical protein OsI_26259 [Oryza sativa Indica Group] gi|222637167|gb|EEE67299.1| hypothetical protein OsJ_24505 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 74 | ||||||
| TAIR|locus:2136491 | 532 | PDIL5-4 "PDI-like 5-4" [Arabid | 0.783 | 0.109 | 0.724 | 2e-17 | |
| TAIR|locus:2085750 | 483 | PDIL5-3 "PDI-like 5-3" [Arabid | 0.689 | 0.105 | 0.784 | 2.4e-16 | |
| TAIR|locus:2036371 | 484 | AT1G50950 [Arabidopsis thalian | 0.689 | 0.105 | 0.725 | 2.3e-15 | |
| UNIPROTKB|Q5EAE0 | 383 | ERGIC3 "Endoplasmic reticulum- | 0.756 | 0.146 | 0.438 | 2.5e-06 | |
| UNIPROTKB|Q9Y282 | 383 | ERGIC3 "Endoplasmic reticulum- | 0.756 | 0.146 | 0.421 | 8.9e-06 | |
| MGI|MGI:1913616 | 383 | Ergic3 "ERGIC and golgi 3" [Mu | 0.756 | 0.146 | 0.421 | 8.9e-06 | |
| TAIR|locus:2034330 | 489 | AT1G36050 "AT1G36050" [Arabido | 0.756 | 0.114 | 0.423 | 1.3e-05 | |
| TAIR|locus:2087817 | 354 | AT3G22290 "AT3G22290" [Arabido | 0.756 | 0.158 | 0.421 | 3.5e-05 | |
| POMBASE|SPAC24B11.08c | 390 | SPAC24B11.08c "COPII-coated ve | 0.756 | 0.143 | 0.368 | 5.3e-05 | |
| ZFIN|ZDB-GENE-040426-795 | 383 | ergic3 "ERGIC and golgi 3" [Da | 0.756 | 0.146 | 0.403 | 6.5e-05 |
| TAIR|locus:2136491 PDIL5-4 "PDI-like 5-4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 221 (82.9 bits), Expect = 2.0e-17, P = 2.0e-17
Identities = 42/58 (72%), Positives = 50/58 (86%)
Query: 1 MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGT 58
M+ ELNNYL V+TST+VIVD+S DGDFLR+DFN+SFPSL CEFAS+DVS+VLGT
Sbjct: 90 MIFLFGMELNNYLAVSTSTSVIVDRSADGDFLRLDFNISFPSLSCEFASVDVSDVLGT 147
|
|
| TAIR|locus:2085750 PDIL5-3 "PDI-like 5-3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036371 AT1G50950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EAE0 ERGIC3 "Endoplasmic reticulum-Golgi intermediate compartment protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y282 ERGIC3 "Endoplasmic reticulum-Golgi intermediate compartment protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913616 Ergic3 "ERGIC and golgi 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034330 AT1G36050 "AT1G36050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087817 AT3G22290 "AT3G22290" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC24B11.08c SPAC24B11.08c "COPII-coated vesicle component Erv46 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-795 ergic3 "ERGIC and golgi 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 74 | |||
| pfam13850 | 105 | pfam13850, ERGIC_N, Endoplasmic Reticulum-Golgi In | 5e-14 |
| >gnl|CDD|206021 pfam13850, ERGIC_N, Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) | Back alignment and domain information |
|---|
Score = 60.6 bits (148), Expect = 5e-14
Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 1/58 (1%)
Query: 1 MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGT 58
++ + EL +YLT T ++VD S G+ LRI+ +++FP LPC+ S+DV +V G
Sbjct: 33 IIILFVSELRDYLTPVTRPELVVDTS-RGEKLRINLDITFPRLPCDLLSLDVMDVSGE 89
|
This family is the N-terminal of ERGIC proteins, ER-Golgi intermediate compartment clusters, otherwise known as Ervs, and is associated with family COPIIcoated_ERV, pfam07970. Length = 105 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 74 | |||
| PF13850 | 96 | ERGIC_N: Endoplasmic Reticulum-Golgi Intermediate | 99.91 | |
| KOG2667 | 379 | consensus COPII vesicle protein [Intracellular tra | 99.83 |
| >PF13850 ERGIC_N: Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) | Back alignment and domain information |
|---|
Probab=99.91 E-value=4e-25 Score=134.62 Aligned_cols=64 Identities=33% Similarity=0.695 Sum_probs=60.9
Q ss_pred CEEEeeehhhhccccceEEEEEEcCCCCCceEEEEEeEEEccccceeeeeeeeecCCceeecccC
Q 035056 1 MVTFILQELNNYLTVTTSTAVIVDKSTDGDFLRIDFNMSFPSLPCEFASIDVSNVLGTVSYSSCQ 65 (74)
Q Consensus 1 ~~~L~~~E~~~y~~~~~~~~l~VD~~~~~~~l~In~DItfp~~pC~~lsvDv~D~~G~~~~~i~~ 65 (74)
|++|+++|+++|+++++++++.||++++ ++++||||||||+|||++|++|++|++|+++.|++|
T Consensus 33 ~~~L~~~E~~~y~~~~~~~~~~VD~~~~-~~l~in~ditf~~~pC~~l~vDv~D~~G~~~~dv~h 96 (96)
T PF13850_consen 33 IVILFISELYSYLSGEIKYQLVVDTSRD-EKLQINFDITFPHMPCDFLSVDVQDASGDHQLDVTH 96 (96)
T ss_pred HHHHHHHHHHHHcccceeEEEEEcCCCC-ceEEEEEEEEECCCccCeeeeEeEccCCCeeccccC
Confidence 3578999999999999999999999888 999999999999999999999999999999999976
|
|
| >KOG2667 consensus COPII vesicle protein [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00