Citrus Sinensis ID: 035132

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MNKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
cccccccEEccEEEEEEccEEHHccccEEEEEHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcc
*NKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cationic amino acid transporter 3, mitochondrial Permease involved in the transport of the cationic neutral or acidic amino acids.probableQ8GYB4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 2-70
View the alignment between query and template
View the model in PyMOL