Citrus Sinensis ID: 035132


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--
MNKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
cccccccEEccEEEEEEccEEHHccccEEEEEHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcc
cccccccEEccEEEEEEHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mnksvdstlgaGAYILVGTVarehsgpaltlsfpyswnsfcFFSLLLCRACKSLAICWECLSLFIHMCWRRC
mnksvdstlgAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
MNKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
********LGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWR**
*NKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
MNKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
****VDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYSWNSFCFFSLLLCRACKSLAICWECLSLFIHMCWRRC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query72 2.2.26 [Sep-21-2011]
Q8GYB4 609 Cationic amino acid trans yes no 0.416 0.049 0.833 5e-07
Q9ASS7 635 Cationic amino acid trans no no 0.416 0.047 0.766 3e-06
Q8W4K3 600 Cationic amino acid trans no no 0.416 0.05 0.733 4e-06
Q09143 622 High affinity cationic am yes no 0.402 0.046 0.655 0.0001
P30823 624 High affinity cationic am yes no 0.402 0.046 0.655 0.0001
P30825 629 High affinity cationic am yes no 0.402 0.046 0.655 0.0002
>sp|Q8GYB4|CAAT3_ARATH Cationic amino acid transporter 3, mitochondrial OS=Arabidopsis thaliana GN=CAT3 PE=2 SV=1 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/30 (83%), Positives = 26/30 (86%)

Query: 4  SVDSTLGAGAYILVGTVAREHSGPALTLSF 33
           V ST+GAG YILVGTVAREHSGPAL LSF
Sbjct: 42 GVGSTIGAGVYILVGTVAREHSGPALALSF 71




Permease involved in the transport of the cationic neutral or acidic amino acids.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=1 SV=1 Back     alignment and function description
>sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=1 SV=1 Back     alignment and function description
>sp|Q09143|CTR1_MOUSE High affinity cationic amino acid transporter 1 OS=Mus musculus GN=Slc7a1 PE=2 SV=1 Back     alignment and function description
>sp|P30823|CTR1_RAT High affinity cationic amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a1 PE=2 SV=1 Back     alignment and function description
>sp|P30825|CTR1_HUMAN High affinity cationic amino acid transporter 1 OS=Homo sapiens GN=SLC7A1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
225439247 639 PREDICTED: high affinity cationic amino 0.583 0.065 0.595 8e-06
296085920 619 unnamed protein product [Vitis vinifera] 0.569 0.066 0.608 8e-06
414869027 624 TPA: hypothetical protein ZEAMMB73_21705 0.569 0.065 0.608 9e-06
392937547 650 cationic amino acid transporter 2 [Solan 0.569 0.063 0.608 9e-06
357155746 635 PREDICTED: high affinity cationic amino 0.583 0.066 0.595 9e-06
326529443 633 predicted protein [Hordeum vulgare subsp 0.569 0.064 0.608 1e-05
403224705 595 putative cationic amino acid transporter 0.402 0.048 0.862 1e-05
77556627 505 amino acid permease family protein, puta 0.569 0.081 0.586 1e-05
77556626 563 amino acid permease family protein, puta 0.569 0.072 0.586 1e-05
115489644 621 Os12g0623500 [Oryza sativa Japonica Grou 0.402 0.046 0.827 2e-05
>gi|225439247|ref|XP_002271330.1| PREDICTED: high affinity cationic amino acid transporter 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 54.7 bits (130), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 5/47 (10%)

Query: 4  SVDSTLGAGAYILVGTVAREHSGPALTLSF-----PYSWNSFCFFSL 45
           V ST+GAG YILVGTVAREHSGPALT+SF       + ++FC+  L
Sbjct: 52 GVGSTIGAGVYILVGTVAREHSGPALTISFLIAGIAAALSAFCYAEL 98




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085920|emb|CBI31244.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|414869027|tpg|DAA47584.1| TPA: hypothetical protein ZEAMMB73_217051 [Zea mays] Back     alignment and taxonomy information
>gi|392937547|gb|AFM93785.1| cationic amino acid transporter 2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|357155746|ref|XP_003577224.1| PREDICTED: high affinity cationic amino acid transporter 1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|326529443|dbj|BAK04668.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326533870|dbj|BAJ93708.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|403224705|emb|CCJ47142.1| putative cationic amino acid transporter, partial [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|77556627|gb|ABA99423.1| amino acid permease family protein, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|77556626|gb|ABA99422.1| amino acid permease family protein, putative, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115489644|ref|NP_001067309.1| Os12g0623500 [Oryza sativa Japonica Group] gi|77556625|gb|ABA99421.1| amino acid permease family protein, putative, expressed [Oryza sativa Japonica Group] gi|113649816|dbj|BAF30328.1| Os12g0623500 [Oryza sativa Japonica Group] gi|215694025|dbj|BAG89224.1| unnamed protein product [Oryza sativa Japonica Group] gi|215765383|dbj|BAG87080.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
TAIR|locus:2167462 609 CAT3 "cationic amino acid tran 0.569 0.067 0.608 4.3e-07
TAIR|locus:2196245 635 CAT2 "cationic amino acid tran 0.402 0.045 0.793 2.6e-06
UNIPROTKB|Q5JR49121 SLC7A1 "High affinity cationic 0.402 0.239 0.655 9e-06
ZFIN|ZDB-GENE-041114-206 644 slc7a3a "solute carrier family 0.402 0.045 0.655 1.9e-05
UNIPROTKB|F1RSU0 429 SLC7A1 "Uncharacterized protei 0.402 0.067 0.689 7.8e-05
ZFIN|ZDB-GENE-091116-69 652 slc7a1 "solute carrier family 0.402 0.044 0.689 8.4e-05
ZFIN|ZDB-GENE-040426-2105 653 zgc:63694 "zgc:63694" [Danio r 0.402 0.044 0.689 8.4e-05
UNIPROTKB|G3MV65 622 Slc7a1 "Solute carrier family 0.402 0.046 0.655 0.00013
UNIPROTKB|G3MV66 622 Slc7a1 "Solute carrier family 0.402 0.046 0.655 0.00013
MGI|MGI:88117 622 Slc7a1 "solute carrier family 0.402 0.046 0.655 0.00013
TAIR|locus:2167462 CAT3 "cationic amino acid transporter 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 126 (49.4 bits), Expect = 4.3e-07, P = 4.3e-07
 Identities = 28/46 (60%), Positives = 33/46 (71%)

Query:     5 VDSTLGAGAYILVGTVAREHSGPALTLSF-----PYSWNSFCFFSL 45
             V ST+GAG YILVGTVAREHSGPAL LSF       + ++FC+  L
Sbjct:    43 VGSTIGAGVYILVGTVAREHSGPALALSFLIAGISAALSAFCYAEL 88




GO:0003333 "amino acid transmembrane transport" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0015171 "amino acid transmembrane transporter activity" evidence=IEA
GO:0015326 "cationic amino acid transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0015174 "basic amino acid transmembrane transporter activity" evidence=IGI
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2196245 CAT2 "cationic amino acid transporter 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JR49 SLC7A1 "High affinity cationic amino acid transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-206 slc7a3a "solute carrier family 7 (cationic amino acid transporter, y+ system), member 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSU0 SLC7A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091116-69 slc7a1 "solute carrier family 7 (cationic amino acid transporter, y+ system), member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2105 zgc:63694 "zgc:63694" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3MV65 Slc7a1 "Solute carrier family 7 member 1" [Mus musculus musculus (taxid:39442)] Back     alignment and assigned GO terms
UNIPROTKB|G3MV66 Slc7a1 "Solute carrier family 7 member 1" [Mus musculus molossinus (taxid:57486)] Back     alignment and assigned GO terms
MGI|MGI:88117 Slc7a1 "solute carrier family 7 (cationic amino acid transporter, y+ system), member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GYB4CAAT3_ARATHNo assigned EC number0.83330.41660.0492yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

No confident hit detected by STRING


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query72
TIGR00906 557 TIGR00906, 2A0303, cationic amino acid transport p 7e-07
>gnl|CDD|129984 TIGR00906, 2A0303, cationic amino acid transport permease Back     alignment and domain information
 Score = 44.0 bits (104), Expect = 7e-07
 Identities = 19/32 (59%), Positives = 23/32 (71%)

Query: 5  VDSTLGAGAYILVGTVAREHSGPALTLSFPYS 36
          + ST+GAG Y+L G VAR  SGPA+ LSF  S
Sbjct: 40 IGSTIGAGIYVLTGEVARNDSGPAIVLSFLIS 71


[Transport and binding proteins, Amino acids, peptides and amines]. Length = 557

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 72
PRK10197 446 gamma-aminobutyrate transporter; Provisional 99.56
PRK10836 489 lysine transporter; Provisional 99.54
PRK11021 410 putative transporter; Provisional 99.53
PRK10249 458 phenylalanine transporter; Provisional 99.5
PRK15049 499 L-asparagine permease; Provisional 99.5
TIGR00906 557 2A0303 cationic amino acid transport permease. 99.48
PRK11387 471 S-methylmethionine transporter; Provisional 99.46
PRK10746 461 putative transport protein YifK; Provisional 99.46
PRK10238 456 aromatic amino acid transporter; Provisional 99.44
PRK10435 435 cadB lysine/cadaverine antiporter; Provisional 99.44
PRK10580 457 proY putative proline-specific permease; Provision 99.42
TIGR01773 452 GABAperm gamma-aminobutyrate permease. GabP is hig 99.41
KOG1286 554 consensus Amino acid transporters [Amino acid tran 99.37
PRK10655 438 potE putrescine transporter; Provisional 99.37
PRK10644 445 arginine:agmatin antiporter; Provisional 99.36
KOG1287 479 consensus Amino acid transporters [Amino acid tran 99.3
TIGR03810 468 arg_ornith_anti arginine/ornithine antiporter. Mem 99.3
TIGR00913 478 2A0310 amino acid permease (yeast). 99.25
TIGR00905 473 2A0302 transporter, basic amino acid/polyamine ant 99.25
PRK11357 445 frlA putative fructoselysine transporter; Provisio 99.24
PRK11049 469 D-alanine/D-serine/glycine permease; Provisional 99.21
TIGR00911 501 2A0308 L-type amino acid transporter. 99.21
COG1113 462 AnsP Gamma-aminobutyrate permease and related perm 99.16
COG0833 541 LysP Amino acid transporters [Amino acid transport 99.11
TIGR00909 429 2A0306 amino acid transporter. 99.05
TIGR00837 381 araaP aromatic amino acid transport protein. aroma 98.99
TIGR03428 475 ureacarb_perm permease, urea carboxylase system. A 98.97
PF00324 478 AA_permease: Amino acid permease; InterPro: IPR004 98.94
PF13520 426 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3G 98.91
TIGR00907 482 2A0304 amino acid permease (GABA permease). 98.82
TIGR00908 442 2A0305 ethanolamine permease. The three genes used 98.76
TIGR00930 953 2a30 K-Cl cotransporter. 98.7
COG0531 466 PotE Amino acid transporters [Amino acid transport 98.44
TIGR00912 359 2A0309 spore germination protein (amino acid perme 98.44
PRK15238 496 inner membrane transporter YjeM; Provisional 98.42
TIGR03813 474 put_Glu_GABA_T putative glutamate/gamma-aminobutyr 98.23
PHA02764 399 hypothetical protein; Provisional 97.97
PF03222 394 Trp_Tyr_perm: Tryptophan/tyrosine permease family; 97.19
TIGR00910 507 2A0307_GadC glutamate:gamma-aminobutyrate antiport 97.14
KOG1289 550 consensus Amino acid transporters [Amino acid tran 96.73
PRK09664 415 tryptophan permease TnaB; Provisional 96.37
TIGR00814 397 stp serine transporter. The HAAAP family includes 96.37
PRK10483 414 tryptophan permease; Provisional 96.31
PRK15132 403 tyrosine transporter TyrP; Provisional 96.07
COG0814 415 SdaC Amino acid permeases [Amino acid transport an 95.95
PRK13629 443 threonine/serine transporter TdcC; Provisional 94.6
TIGR00796 378 livcs branched-chain amino acid uptake carrier. tr 93.04
PF03845 320 Spore_permease: Spore germination protein; InterPr 92.37
PF01235 416 Na_Ala_symp: Sodium:alanine symporter family; Inte 84.25
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
Probab=99.56  E-value=6e-15  Score=110.66  Aligned_cols=65  Identities=12%  Similarity=0.113  Sum_probs=60.4

Q ss_pred             eEeecceecchhhhhhHHHHHhccchHHHHHHHHH-----HHHHHHHHhHhhccCCCCCcHHHHHHHHHHHhh
Q 035132            2 NKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYS-----WNSFCFFSLLLCRACKSLAICWECLSLFIHMCW   69 (72)
Q Consensus         2 ~l~vG~~IGsGIF~~~g~v~~~~aGp~~~la~li~-----~~al~yaEL~~~~~~P~~Gg~~~~~~~~~~~~~   69 (72)
                      ++++|++||+|+|++||..++ .+||..+++|+++     +.++||+||+ ++ +|++||.|+|++++.|+-|
T Consensus         1 ~~~ig~~IGsGif~~~g~~~~-~aG~~~ll~~~i~gi~~~~~al~~aEL~-s~-~P~~Gg~y~y~~~~~G~~~   70 (446)
T PRK10197          1 MLSIAGVIGASLFVGSSVAIA-EAGPAVLLAYLFAGLLVVMIMRMLAEMA-VA-TPDTGSFSTYADKAIGRWA   70 (446)
T ss_pred             CeeecchhHhHHHHHhHHHHH-hcChHHHHHHHHHHHHHHHHHHHHHHHH-Hh-CCCCCCHHHHHHHHcChHH
Confidence            589999999999999999885 6899999999998     8899999999 98 9999999999999999754



>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>PRK15049 L-asparagine permease; Provisional Back     alignment and domain information
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>TIGR01773 GABAperm gamma-aminobutyrate permease Back     alignment and domain information
>KOG1286 consensus Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>KOG1287 consensus Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03810 arg_ornith_anti arginine/ornithine antiporter Back     alignment and domain information
>TIGR00913 2A0310 amino acid permease (yeast) Back     alignment and domain information
>TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>TIGR00837 araaP aromatic amino acid transport protein Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>PF00324 AA_permease: Amino acid permease; InterPro: IPR004841 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PF13520 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3GI8_C 3GIA_A 3GI9_C 3OB6_A 3L1L_A 3LRC_D 3LRB_B 4DJK_A 4DJI_A Back     alignment and domain information
>TIGR00907 2A0304 amino acid permease (GABA permease) Back     alignment and domain information
>TIGR00908 2A0305 ethanolamine permease Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00912 2A0309 spore germination protein (amino acid permease) Back     alignment and domain information
>PRK15238 inner membrane transporter YjeM; Provisional Back     alignment and domain information
>TIGR03813 put_Glu_GABA_T putative glutamate/gamma-aminobutyrate antiporter Back     alignment and domain information
>PHA02764 hypothetical protein; Provisional Back     alignment and domain information
>PF03222 Trp_Tyr_perm: Tryptophan/tyrosine permease family; InterPro: IPR018227 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>TIGR00910 2A0307_GadC glutamate:gamma-aminobutyrate antiporter Back     alignment and domain information
>KOG1289 consensus Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09664 tryptophan permease TnaB; Provisional Back     alignment and domain information
>TIGR00814 stp serine transporter Back     alignment and domain information
>PRK10483 tryptophan permease; Provisional Back     alignment and domain information
>PRK15132 tyrosine transporter TyrP; Provisional Back     alignment and domain information
>COG0814 SdaC Amino acid permeases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13629 threonine/serine transporter TdcC; Provisional Back     alignment and domain information
>TIGR00796 livcs branched-chain amino acid uptake carrier Back     alignment and domain information
>PF03845 Spore_permease: Spore germination protein; InterPro: IPR004761 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PF01235 Na_Ala_symp: Sodium:alanine symporter family; InterPro: IPR001463 Sodium symporters can be divided by sequence and functional similarity into various groups Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 99.25
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 99.25
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 98.45
1ter_A26 Tertiapin; toxin; NMR {Apis mellifera} SCOP: j.20. 89.01
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure
Probab=99.25  E-value=2.4e-12  Score=92.27  Aligned_cols=65  Identities=11%  Similarity=0.084  Sum_probs=57.1

Q ss_pred             eEeecceecchhhhhhHHHHHhccchHHHHHHHHH-----HHHHHHHHhHhhccCCCCCcHHHHHHHHHHHhhh
Q 035132            2 NKSVDSTLGAGAYILVGTVAREHSGPALTLSFPYS-----WNSFCFFSLLLCRACKSLAICWECLSLFIHMCWR   70 (72)
Q Consensus         2 ~l~vG~~IGsGIF~~~g~v~~~~aGp~~~la~li~-----~~al~yaEL~~~~~~P~~Gg~~~~~~~~~~~~~~   70 (72)
                      ++.+|++||+|+|..|+.+.  .+||..+++|+++     +.+++|+|++ ++ +|++||.|+|+++..|+-+.
T Consensus        17 ~l~ig~~iG~Gif~~~~~~~--~~G~~~~~~~li~~~~~~~~a~~~~el~-~~-~p~~Gg~y~~~~~~~G~~~g   86 (445)
T 3l1l_A           17 LMVSGAIMGSGVFLLPANLA--STGGIAIYGWLVTIIGALGLSMVYAKMS-FL-DPSPGGSYAYARRCFGPFLG   86 (445)
T ss_dssp             HHHHHHHCSSHHHHHHHHHH--HHCTHHHHHHHHHHHHHHHHHHHHHHHH-HH-CCCTTTHHHHHHHHSCHHHH
T ss_pred             HHHHHhHHhhhHHhhHHHHH--HhhhHHHHHHHHHHHHHHHHHHHHHHHH-cc-CCCCCCchhhHHhHcCChHH
Confidence            35689999999999999854  3799988999888     8889999999 98 99999999999999887653



>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure
>1ter_A Tertiapin; toxin; NMR {Apis mellifera} SCOP: j.20.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00