Citrus Sinensis ID: 035162


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-
MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPCIPSECVGLRETYFNCKRGQVDMRARIRGNKGY
ccHHHHHHHHHHHHHHHcccccccccccHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccc
***SCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPCIPSECVGLRETYFNCKRGQVDMRARIRGN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPCIPSECVGLRETYFNCKRGQVDMRARIRGNKGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase assembly factor 5 Involved in an early step of the mitochondrial complex IV assembly process.probableQ0P451
Cytochrome c oxidase assembly factor 5 Involved in an early step of the mitochondrial complex IV assembly process.probableQ28CA1
Cytochrome c oxidase assembly factor 5 Involved in an early step of the mitochondrial complex IV assembly process.probableQ99M07

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HP8, chain A
Confidence level:probable
Coverage over the Query: 29-63
View the alignment between query and template
View the model in PyMOL