Citrus Sinensis ID: 035170
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| 68138959 | 380 | alcohol dehydrogenase [Citrus x paradisi | 1.0 | 0.186 | 1.0 | 1e-35 | |
| 224066747 | 380 | predicted protein [Populus trichocarpa] | 0.985 | 0.184 | 0.9 | 5e-33 | |
| 255587152 | 380 | alcohol dehydrogenase, putative [Ricinus | 1.0 | 0.186 | 0.943 | 1e-32 | |
| 9885272 | 380 | alcohol dehydrogenase 1 [Vitis vinifera] | 0.985 | 0.184 | 0.9 | 2e-32 | |
| 295148815 | 380 | alcohol dehydrogenase I [Vitis aestivali | 0.985 | 0.184 | 0.9 | 2e-32 | |
| 225431503 | 380 | PREDICTED: alcohol dehydrogenase 1 [Viti | 0.985 | 0.184 | 0.9 | 3e-32 | |
| 295148819 | 380 | alcohol dehydrogenase I [Vitis cinerea] | 0.985 | 0.184 | 0.9 | 3e-32 | |
| 295148817 | 380 | alcohol dehydrogenase I [Vitis californi | 0.985 | 0.184 | 0.9 | 3e-32 | |
| 225457787 | 380 | PREDICTED: alcohol dehydrogenase 1 [Viti | 0.985 | 0.184 | 0.9 | 3e-32 | |
| 147838940 | 380 | hypothetical protein VITISV_043875 [Viti | 0.985 | 0.184 | 0.9 | 4e-32 |
| >gi|68138959|gb|AAY86033.1| alcohol dehydrogenase [Citrus x paradisi] | Back alignment and taxonomy information |
|---|
Score = 153 bits (387), Expect = 1e-35, Method: Composition-based stats.
Identities = 71/71 (100%), Positives = 71/71 (100%)
Query: 1 MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRG 60
MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRG
Sbjct: 310 MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRG 369
Query: 61 EGLRCIIRMEE 71
EGLRCIIRMEE
Sbjct: 370 EGLRCIIRMEE 380
|
Source: Citrus x paradisi Species: Citrus x paradisi Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224066747|ref|XP_002302195.1| predicted protein [Populus trichocarpa] gi|118486976|gb|ABK95320.1| unknown [Populus trichocarpa] gi|222843921|gb|EEE81468.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255587152|ref|XP_002534157.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223525768|gb|EEF28223.1| alcohol dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|9885272|gb|AAG01381.1|AF194173_1 alcohol dehydrogenase 1 [Vitis vinifera] gi|1840425|gb|AAB65840.1| alcohol dehydrogenase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|295148815|gb|ADF80905.1| alcohol dehydrogenase I [Vitis aestivalis] | Back alignment and taxonomy information |
|---|
| >gi|225431503|ref|XP_002281363.1| PREDICTED: alcohol dehydrogenase 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|295148819|gb|ADF80907.1| alcohol dehydrogenase I [Vitis cinerea] | Back alignment and taxonomy information |
|---|
| >gi|295148817|gb|ADF80906.1| alcohol dehydrogenase I [Vitis californica] | Back alignment and taxonomy information |
|---|
| >gi|225457787|ref|XP_002265158.1| PREDICTED: alcohol dehydrogenase 1 [Vitis vinifera] gi|302142758|emb|CBI19961.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147838940|emb|CAN68099.1| hypothetical protein VITISV_043875 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 71 | ||||||
| TAIR|locus:2025237 | 379 | ADH1 "alcohol dehydrogenase 1" | 0.971 | 0.182 | 0.826 | 2.4e-28 | |
| TAIR|locus:2184575 | 381 | AT5G24760 [Arabidopsis thalian | 0.929 | 0.173 | 0.545 | 1.2e-16 | |
| TAIR|locus:2009512 | 386 | AT1G22440 [Arabidopsis thalian | 0.985 | 0.181 | 0.485 | 5.7e-14 | |
| TAIR|locus:2120663 | 389 | AT4G22110 [Arabidopsis thalian | 0.985 | 0.179 | 0.457 | 2.7e-13 | |
| UNIPROTKB|F1S0C1 | 374 | ADH5 "Uncharacterized protein" | 0.943 | 0.179 | 0.447 | 8.6e-13 | |
| UNIPROTKB|Q3ZC42 | 374 | ADH5 "Alcohol dehydrogenase cl | 0.943 | 0.179 | 0.417 | 2.4e-12 | |
| UNIPROTKB|P11766 | 374 | ADH5 "Alcohol dehydrogenase cl | 0.943 | 0.179 | 0.447 | 2.4e-12 | |
| DICTYBASE|DDB_G0281865 | 379 | adh5 "alcohol dehydrogenase, c | 0.943 | 0.176 | 0.447 | 3.2e-12 | |
| TAIR|locus:2009522 | 388 | AT1G22430 [Arabidopsis thalian | 0.985 | 0.180 | 0.442 | 5.6e-12 | |
| ZFIN|ZDB-GENE-011003-1 | 376 | adh5 "alcohol dehydrogenase 5" | 0.929 | 0.175 | 0.439 | 6.6e-12 |
| TAIR|locus:2025237 ADH1 "alcohol dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 316 (116.3 bits), Expect = 2.4e-28, P = 2.4e-28
Identities = 57/69 (82%), Positives = 65/69 (94%)
Query: 1 MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRG 60
MN LNERTLKGTFFGNYKP++D+P VVEKYM+KELE+EKFITHTVPFSEINKAF+YML+G
Sbjct: 309 MNFLNERTLKGTFFGNYKPKTDIPGVVEKYMNKELELEKFITHTVPFSEINKAFDYMLKG 368
Query: 61 EGLRCIIRM 69
E +RCII M
Sbjct: 369 ESIRCIITM 377
|
|
| TAIR|locus:2184575 AT5G24760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009512 AT1G22440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120663 AT4G22110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S0C1 ADH5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZC42 ADH5 "Alcohol dehydrogenase class-3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11766 ADH5 "Alcohol dehydrogenase class-3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0281865 adh5 "alcohol dehydrogenase, class 3" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009522 AT1G22430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-011003-1 adh5 "alcohol dehydrogenase 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| Adh1 | SubName- Full=Putative uncharacterized protein; (381 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.XI.3391.1 | • | 0.899 | |||||||||
| gw1.V.2645.1 | • | 0.899 | |||||||||
| gw1.III.2325.1 | • | 0.899 | |||||||||
| gw1.4555.2.1 | • | 0.899 | |||||||||
| gw1.134.62.1 | • | 0.899 | |||||||||
| grail3.0005008802 | • | 0.899 | |||||||||
| fgenesh4_pg.C_LG_II000742 | • | 0.899 | |||||||||
| eugene3.01840014 | • | 0.899 | |||||||||
| eugene3.00060891 | • | 0.899 | |||||||||
| estExt_fgenesh4_pm.C_LG_XVI0442 | • | 0.899 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| cd08301 | 369 | cd08301, alcohol_DH_plants, Plant alcohol dehydrog | 8e-43 | |
| cd08277 | 365 | cd08277, liver_alcohol_DH_like, Liver alcohol dehy | 1e-29 | |
| PLN02827 | 378 | PLN02827, PLN02827, Alcohol dehydrogenase-like | 1e-28 | |
| cd08300 | 368 | cd08300, alcohol_DH_class_III, class III alcohol d | 6e-26 | |
| COG1062 | 366 | COG1062, AdhC, Zn-dependent alcohol dehydrogenases | 2e-22 | |
| cd05279 | 365 | cd05279, Zn_ADH1, Liver alcohol dehydrogenase and | 2e-21 | |
| cd08299 | 373 | cd08299, alcohol_DH_class_I_II_IV, class I, II, IV | 3e-19 | |
| TIGR02818 | 368 | TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat | 4e-19 | |
| PLN02740 | 381 | PLN02740, PLN02740, Alcohol dehydrogenase-like | 5e-19 | |
| cd08279 | 363 | cd08279, Zn_ADH_class_III, Class III alcohol dehyd | 1e-15 | |
| cd08281 | 371 | cd08281, liver_ADH_like1, Zinc-dependent alcohol d | 4e-14 | |
| TIGR03989 | 369 | TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa | 4e-13 | |
| TIGR03451 | 358 | TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi | 4e-09 | |
| cd08236 | 343 | cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog | 5e-08 | |
| cd08235 | 343 | cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas | 7e-08 | |
| cd08263 | 367 | cd08263, Zn_ADH10, Alcohol dehydrogenases of the M | 3e-07 | |
| cd08278 | 365 | cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro | 1e-06 | |
| cd05285 | 343 | cd05285, sorbitol_DH, Sorbitol dehydrogenase | 2e-05 | |
| COG1063 | 350 | COG1063, Tdh, Threonine dehydrogenase and related | 4e-05 | |
| cd05281 | 341 | cd05281, TDH, Threonine dehydrogenase | 8e-05 | |
| COG1064 | 339 | COG1064, AdhP, Zn-dependent alcohol dehydrogenases | 9e-05 | |
| cd08231 | 361 | cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 | 1e-04 | |
| cd08234 | 334 | cd08234, threonine_DH_like, L-threonine dehydrogen | 3e-04 | |
| cd08284 | 344 | cd08284, FDH_like_2, Glutathione-dependent formald | 3e-04 | |
| cd08269 | 312 | cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD | 7e-04 | |
| cd08261 | 337 | cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD | 9e-04 | |
| cd08286 | 345 | cd08286, FDH_like_ADH2, formaldehyde dehydrogenase | 0.001 | |
| cd08239 | 339 | cd08239, THR_DH_like, L-threonine dehydrogenase (T | 0.003 | |
| cd08254 | 338 | cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e | 0.003 |
| >gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
Score = 141 bits (357), Expect = 8e-43
Identities = 50/68 (73%), Positives = 60/68 (88%)
Query: 1 MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRG 60
MNLLN RTLKGT FG YKP++DLP++VEKYM KELE+EKFITH +PFSEINKAF+ +L+G
Sbjct: 302 MNLLNGRTLKGTLFGGYKPKTDLPNLVEKYMKKELELEKFITHELPFSEINKAFDLLLKG 361
Query: 61 EGLRCIIR 68
E LRCI+
Sbjct: 362 ECLRCILH 369
|
NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. There are 7 vertebrate ADH 7 classes, 6 of which have been identified in humans. Class III, glutathione-dependent formaldehyde dehydrogenase, has been identified as the primordial form and exists in diverse species, including plants, micro-organisms, vertebrates, and invertebrates. Class I, typified by liver dehydrogenase, is an evolving form. Gene duplication and functional specialization of ADH into ADH classes and subclasses created numerous forms in vertebrates. For example, the A, B and C (formerly alpha, beta, gamma) human class I subunits have high overall structural similarity, but differ in the substrate binding pocket and therefore in substrate specificity. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine (His-51), the ribose of NAD, a serine (Ser-48) , then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of an beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 369 |
| >gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family | Back alignment and domain information |
|---|
| >gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| COG1062 | 366 | AdhC Zn-dependent alcohol dehydrogenases, class II | 99.69 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 99.49 | |
| KOG0022 | 375 | consensus Alcohol dehydrogenase, class III [Second | 99.47 | |
| PLN02827 | 378 | Alcohol dehydrogenase-like | 99.33 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 99.25 | |
| cd08238 | 410 | sorbose_phosphate_red L-sorbose-1-phosphate reduct | 99.25 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 99.21 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 99.21 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 99.19 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 99.19 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 99.17 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 99.17 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 99.17 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 99.15 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 99.15 | |
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 99.15 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 99.13 | |
| cd08300 | 368 | alcohol_DH_class_III class III alcohol dehydrogena | 99.11 | |
| TIGR02819 | 393 | fdhA_non_GSH formaldehyde dehydrogenase, glutathio | 99.03 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 98.93 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 98.87 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 98.87 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 98.85 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 98.81 | |
| PF13602 | 127 | ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ | 98.81 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 98.81 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 98.77 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 98.76 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 98.75 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 98.73 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 98.6 | |
| cd08242 | 319 | MDR_like Medium chain dehydrogenases/reductase (MD | 98.57 | |
| cd08299 | 373 | alcohol_DH_class_I_II_IV class I, II, IV alcohol d | 98.52 | |
| cd08291 | 324 | ETR_like_1 2-enoyl thioester reductase (ETR) like | 98.48 | |
| cd05279 | 365 | Zn_ADH1 Liver alcohol dehydrogenase and related zi | 98.39 | |
| PRK10083 | 339 | putative oxidoreductase; Provisional | 98.39 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 98.33 | |
| cd08287 | 345 | FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik | 98.33 | |
| cd08262 | 341 | Zn_ADH8 Alcohol dehydrogenases of the MDR family. | 98.26 | |
| cd08286 | 345 | FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik | 98.2 | |
| cd08282 | 375 | PFDH_like Pseudomonas putida aldehyde-dismutating | 98.17 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 98.15 | |
| cd08278 | 365 | benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be | 98.12 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 98.11 | |
| cd08265 | 384 | Zn_ADH3 Alcohol dehydrogenases of the MDR family. | 98.09 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 98.06 | |
| cd05283 | 337 | CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam | 98.04 | |
| cd08232 | 339 | idonate-5-DH L-idonate 5-dehydrogenase. L-idonate | 98.03 | |
| cd08256 | 350 | Zn_ADH2 Alcohol dehydrogenases of the MDR family. | 98.03 | |
| TIGR00692 | 340 | tdh L-threonine 3-dehydrogenase. E. coli His-90 mo | 98.01 | |
| cd08279 | 363 | Zn_ADH_class_III Class III alcohol dehydrogenase. | 98.01 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 98.0 | |
| PLN02702 | 364 | L-idonate 5-dehydrogenase | 97.98 | |
| cd05281 | 341 | TDH Threonine dehydrogenase. L-threonine dehydroge | 97.97 | |
| cd08263 | 367 | Zn_ADH10 Alcohol dehydrogenases of the MDR family. | 97.94 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 97.94 | |
| cd08284 | 344 | FDH_like_2 Glutathione-dependent formaldehyde dehy | 97.93 | |
| PRK13771 | 334 | putative alcohol dehydrogenase; Provisional | 97.9 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 97.89 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 97.88 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 97.83 | |
| cd08246 | 393 | crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- | 97.82 | |
| cd08260 | 345 | Zn_ADH6 Alcohol dehydrogenases of the MDR family. | 97.81 | |
| cd08235 | 343 | iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ | 97.74 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 97.74 | |
| cd05285 | 343 | sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a | 97.7 | |
| TIGR01751 | 398 | crot-CoA-red crotonyl-CoA reductase. The enzyme mo | 97.66 | |
| PRK10754 | 327 | quinone oxidoreductase, NADPH-dependent; Provision | 97.66 | |
| cd05284 | 340 | arabinose_DH_like D-arabinose dehydrogenase. This | 97.65 | |
| cd08269 | 312 | Zn_ADH9 Alcohol dehydrogenases of the MDR family. | 97.62 | |
| cd08266 | 342 | Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam | 97.62 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 97.59 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 97.57 | |
| cd08270 | 305 | MDR4 Medium chain dehydrogenases/reductase (MDR)/z | 97.56 | |
| cd05278 | 347 | FDH_like Formaldehyde dehydrogenases. Formaldehyde | 97.53 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 97.48 | |
| cd08259 | 332 | Zn_ADH5 Alcohol dehydrogenases of the MDR family. | 97.47 | |
| cd08240 | 350 | 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy | 97.45 | |
| cd08244 | 324 | MDR_enoyl_red Possible enoyl reductase. Member ide | 97.42 | |
| PRK09422 | 338 | ethanol-active dehydrogenase/acetaldehyde-active r | 97.4 | |
| cd08234 | 334 | threonine_DH_like L-threonine dehydrogenase. L-thr | 97.39 | |
| cd08261 | 337 | Zn_ADH7 Alcohol dehydrogenases of the MDR family. | 97.38 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 97.37 | |
| cd08276 | 336 | MDR7 Medium chain dehydrogenases/reductase (MDR)/z | 97.36 | |
| cd08298 | 329 | CAD2 Cinnamyl alcohol dehydrogenases (CAD). These | 97.33 | |
| KOG1197 | 336 | consensus Predicted quinone oxidoreductase [Energy | 97.33 | |
| cd08236 | 343 | sugar_DH NAD(P)-dependent sugar dehydrogenases. Th | 97.31 | |
| cd08297 | 341 | CAD3 Cinnamyl alcohol dehydrogenases (CAD). These | 97.12 | |
| cd08250 | 329 | Mgc45594_like Mgc45594 gene product and other MDR | 97.1 | |
| cd05280 | 325 | MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone | 97.1 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 97.08 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 97.01 | |
| PTZ00354 | 334 | alcohol dehydrogenase; Provisional | 96.99 | |
| cd08245 | 330 | CAD Cinnamyl alcohol dehydrogenases (CAD) and rela | 96.95 | |
| cd08243 | 320 | quinone_oxidoreductase_like_1 Quinone oxidoreducta | 96.92 | |
| cd08255 | 277 | 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ | 96.89 | |
| cd05288 | 329 | PGDH Prostaglandin dehydrogenases. Prostaglandins | 96.71 | |
| KOG0025 | 354 | consensus Zn2+-binding dehydrogenase (nuclear rece | 96.71 | |
| cd08290 | 341 | ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi | 96.63 | |
| cd08247 | 352 | AST1_like AST1 is a cytoplasmic protein associated | 96.62 | |
| cd05286 | 320 | QOR2 Quinone oxidoreductase (QOR). Quinone oxidore | 96.55 | |
| cd08273 | 331 | MDR8 Medium chain dehydrogenases/reductase (MDR)/z | 96.4 | |
| cd08288 | 324 | MDR_yhdh Yhdh putative quinone oxidoreductases. Yh | 96.38 | |
| cd08241 | 323 | QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t | 96.37 | |
| cd08248 | 350 | RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu | 96.34 | |
| cd08275 | 337 | MDR3 Medium chain dehydrogenases/reductase (MDR)/z | 96.32 | |
| cd08289 | 326 | MDR_yhfp_like Yhfp putative quinone oxidoreductase | 96.3 | |
| cd08264 | 325 | Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam | 96.23 | |
| cd05289 | 309 | MDR_like_2 alcohol dehydrogenase and quinone reduc | 96.2 | |
| cd05276 | 323 | p53_inducible_oxidoreductase PIG3 p53-inducible qu | 96.19 | |
| cd08272 | 326 | MDR6 Medium chain dehydrogenases/reductase (MDR)/z | 96.13 | |
| cd08249 | 339 | enoyl_reductase_like enoyl_reductase_like. Member | 96.12 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 95.95 | |
| KOG1202 | 2376 | consensus Animal-type fatty acid synthase and rela | 95.91 | |
| cd08267 | 319 | MDR1 Medium chain dehydrogenases/reductase (MDR)/z | 95.86 | |
| TIGR02823 | 323 | oxido_YhdH putative quinone oxidoreductase, YhdH/Y | 95.84 | |
| cd08252 | 336 | AL_MDR Arginate lyase and other MDR family members | 95.81 | |
| cd08251 | 303 | polyketide_synthase polyketide synthase. Polyketid | 95.71 | |
| cd08271 | 325 | MDR5 Medium chain dehydrogenases/reductase (MDR)/z | 95.64 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 95.43 | |
| smart00829 | 288 | PKS_ER Enoylreductase. Enoylreductase in Polyketid | 95.38 | |
| cd05195 | 293 | enoyl_red enoyl reductase of polyketide synthase. | 95.07 | |
| TIGR02817 | 336 | adh_fam_1 zinc-binding alcohol dehydrogenase famil | 95.0 | |
| TIGR02824 | 325 | quinone_pig3 putative NAD(P)H quinone oxidoreducta | 94.9 | |
| cd08268 | 328 | MDR2 Medium chain dehydrogenases/reductase (MDR)/z | 94.39 | |
| KOG1196 | 343 | consensus Predicted NAD-dependent oxidoreductase [ | 91.39 | |
| PF00107 | 130 | ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: | 90.69 | |
| cd08258 | 306 | Zn_ADH4 Alcohol dehydrogenases of the MDR family. | 90.67 | |
| PF07109 | 97 | Mg-por_mtran_C: Magnesium-protoporphyrin IX methyl | 85.27 |
| >COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=99.69 E-value=4.6e-17 Score=98.23 Aligned_cols=68 Identities=41% Similarity=0.871 Sum_probs=63.2
Q ss_pred CcccceeEeeeeecccccCCCHHHHHHHHHcCCCccccceeeeeehhhHHHHHHHHhcCceeeEEEee
Q 035170 2 NLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEGLRCIIRM 69 (71)
Q Consensus 2 ~~~~~~~i~Gs~~g~~~~~~~~~~~i~l~~~g~~~~~~~it~~~~l~~~~~a~~~~~~~~~~kvvi~~ 69 (71)
.|..+.+|+||++|+..|+.+++++++++.+|+++++++|||+++|+|+++||+.+.+|+.+|.||.+
T Consensus 299 ~lv~gr~~~Gs~~G~~~p~~diP~lv~~y~~Gkl~~d~lvt~~~~Le~INeaf~~m~~G~~IR~Vi~~ 366 (366)
T COG1062 299 QLVTGRVWKGSAFGGARPRSDIPRLVDLYMAGKLPLDRLVTHTIPLEDINEAFDLMHEGKSIRSVIRF 366 (366)
T ss_pred HeeccceEEEEeecCCccccchhHHHHHHHcCCCchhHHhhccccHHHHHHHHHHHhCCceeeEEecC
Confidence 35567899999999888889999999999999999999999999999999999999999999998864
|
|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02827 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08300 alcohol_DH_class_III class III alcohol dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 | Back alignment and domain information |
|---|
| >cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >PRK10083 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK05396 tdh L-threonine 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08232 idonate-5-DH L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >TIGR00692 tdh L-threonine 3-dehydrogenase | Back alignment and domain information |
|---|
| >cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >PLN02702 L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >cd05281 TDH Threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 | Back alignment and domain information |
|---|
| >PRK13771 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08246 crotonyl_coA_red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >cd05285 sorbitol_DH Sorbitol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01751 crot-CoA-red crotonyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional | Back alignment and domain information |
|---|
| >cd05284 arabinose_DH_like D-arabinose dehydrogenase | Back alignment and domain information |
|---|
| >cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd05278 FDH_like Formaldehyde dehydrogenases | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase | Back alignment and domain information |
|---|
| >cd08244 MDR_enoyl_red Possible enoyl reductase | Back alignment and domain information |
|---|
| >PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional | Back alignment and domain information |
|---|
| >cd08234 threonine_DH_like L-threonine dehydrogenase | Back alignment and domain information |
|---|
| >cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases | Back alignment and domain information |
|---|
| >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members | Back alignment and domain information |
|---|
| >cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >PTZ00354 alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins | Back alignment and domain information |
|---|
| >cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members | Back alignment and domain information |
|---|
| >cd05288 PGDH Prostaglandin dehydrogenases | Back alignment and domain information |
|---|
| >KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd08290 ETR 2-enoyl thioester reductase (ETR) | Back alignment and domain information |
|---|
| >cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast | Back alignment and domain information |
|---|
| >cd05286 QOR2 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08241 QOR1 Quinone oxidoreductase (QOR) | Back alignment and domain information |
|---|
| >cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 | Back alignment and domain information |
|---|
| >cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases | Back alignment and domain information |
|---|
| >cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases | Back alignment and domain information |
|---|
| >cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase | Back alignment and domain information |
|---|
| >cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08249 enoyl_reductase_like enoyl_reductase_like | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family | Back alignment and domain information |
|---|
| >cd08252 AL_MDR Arginate lyase and other MDR family members | Back alignment and domain information |
|---|
| >cd08251 polyketide_synthase polyketide synthase | Back alignment and domain information |
|---|
| >cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >smart00829 PKS_ER Enoylreductase | Back alignment and domain information |
|---|
| >cd05195 enoyl_red enoyl reductase of polyketide synthase | Back alignment and domain information |
|---|
| >TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family | Back alignment and domain information |
|---|
| >cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PF07109 Mg-por_mtran_C: Magnesium-protoporphyrin IX methyltransferase C-terminus; InterPro: IPR010940 This entry represents the C terminus (approximately 100 residues) of bacterial and eukaryotic Magnesium-protoporphyrin IX methyltransferase (2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 71 | ||||
| 3uko_A | 378 | Crystal Structure Of S-Nitrosoglutathione Reductase | 3e-14 | ||
| 4dl9_A | 396 | Crystal Structure Of S-nitrosoglutathione Reductase | 4e-14 | ||
| 1teh_A | 373 | Structure Of Human Liver Chichi Alcohol Dehydrogena | 5e-14 | ||
| 3qj5_A | 374 | S-Nitrosoglutathione Reductase (Gsnor) In Complex W | 5e-14 | ||
| 2fzw_A | 373 | Structure Of The Binary Complex Of The E67l Mutant | 5e-14 | ||
| 1mc5_A | 374 | Ternary Complex Of Human Glutathione-Dependent Form | 5e-14 | ||
| 1qv6_A | 374 | Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG | 2e-11 | ||
| 1axe_A | 374 | Crystal Structure Of The Active-Site Mutant Phe93-> | 2e-11 | ||
| 1n8k_A | 374 | Horse Liver Alcohol Dehydrogenase Val292thr Mutant | 2e-11 | ||
| 1qlh_A | 374 | Horse Liver Alcohol Dehydrogenase Complexed To Nad | 2e-11 | ||
| 6adh_A | 374 | Structure Of Triclinic Ternary Complex Of Horse Liv | 2e-11 | ||
| 1a71_A | 374 | Ternary Complex Of An Active Site Double Mutant Of | 2e-11 | ||
| 1axg_A | 374 | Crystal Structure Of The Val203->ala Mutant Of Live | 2e-11 | ||
| 1ju9_A | 374 | Horse Liver Alcohol Dehydrogenase Val292ser Mutant | 2e-11 | ||
| 1mgo_A | 374 | Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L | 2e-11 | ||
| 3oq6_A | 374 | Horse Liver Alcohol Dehydrogenase A317c Mutant Comp | 2e-11 | ||
| 1ee2_B | 373 | The Structure Of Steroid-Active Alcohol Dehydrogena | 6e-11 | ||
| 1ee2_A | 373 | The Structure Of Steroid-Active Alcohol Dehydrogena | 6e-11 | ||
| 3cos_A | 381 | Crystal Structure Of Human Class Ii Alcohol Dehydro | 7e-11 | ||
| 1agn_A | 373 | X-Ray Structure Of Human Sigma Alcohol Dehydrogenas | 8e-11 | ||
| 1d1t_A | 373 | Mutant Of Human Sigma Alcohol Dehydrogenase With Le | 8e-11 | ||
| 1hdx_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 3e-10 | ||
| 1hdy_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 3e-10 | ||
| 1hdz_A | 374 | Three-Dimensional Structures Of Three Human Alcohol | 3e-10 | ||
| 1ht0_A | 374 | Human Gamma-2 Alcohol Dehydrogense Length = 374 | 6e-10 | ||
| 1cdo_A | 374 | Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co | 7e-10 | ||
| 1hso_A | 374 | Human Alpha Alcohol Dehydrogenase (Adh1a) Length = | 9e-10 | ||
| 1e3l_A | 376 | P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase | 2e-09 | ||
| 1e3e_A | 376 | Mouse Class Ii Alcohol Dehydrogenase Complex With N | 2e-09 | ||
| 1htb_A | 374 | Crystallization Of Human Beta3 Alcohol Dehydrogenas | 4e-09 | ||
| 1p0c_A | 373 | Crystal Structure Of The Nadp(H)-Dependent Vertebra | 7e-07 |
| >pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 | Back alignment and structure |
|
| >pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 | Back alignment and structure |
| >pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 | Back alignment and structure |
| >pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 | Back alignment and structure |
| >pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 | Back alignment and structure |
| >pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 | Back alignment and structure |
| >pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 | Back alignment and structure |
| >pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 | Back alignment and structure |
| >pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 | Back alignment and structure |
| >pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 | Back alignment and structure |
| >pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 | Back alignment and structure |
| >pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 | Back alignment and structure |
| >pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 | Back alignment and structure |
| >pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 | Back alignment and structure |
| >pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 | Back alignment and structure |
| >pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 | Back alignment and structure |
| >pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 | Back alignment and structure |
| >pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 | Back alignment and structure |
| >pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 | Back alignment and structure |
| >pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 | Back alignment and structure |
| >pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 | Back alignment and structure |
| >pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 | Back alignment and structure |
| >pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 | Back alignment and structure |
| >pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 | Back alignment and structure |
| >pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 | Back alignment and structure |
| >pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 | Back alignment and structure |
| >pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 | Back alignment and structure |
| >pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 | Back alignment and structure |
| >pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 71 | |||
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 1e-38 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 9e-38 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 7e-35 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 7e-35 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 2e-32 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 3e-28 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 1e-23 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 3e-11 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 9e-11 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 2e-10 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 2e-09 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 3e-09 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 3e-09 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 3e-09 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 1e-08 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 2e-08 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 5e-08 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 8e-08 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 1e-07 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 2e-07 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 5e-07 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 5e-04 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 5e-04 |
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 | Back alignment and structure |
|---|
Score = 129 bits (327), Expect = 1e-38
Identities = 30/69 (43%), Positives = 48/69 (69%)
Query: 1 MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRG 60
L+ RT KGT FG +K +P +V +YMSK+++V++F+TH + F EINKAFE M G
Sbjct: 305 FQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFELMHSG 364
Query: 61 EGLRCIIRM 69
+ +R ++++
Sbjct: 365 KSIRTVVKI 373
|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 99.43 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 99.39 | |
| 4eez_A | 348 | Alcohol dehydrogenase 1; site-saturation mutagenes | 99.28 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 99.26 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 99.26 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 99.25 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 99.25 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 99.24 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 99.23 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 99.22 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 99.2 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 99.2 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 99.16 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 99.16 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 99.15 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 99.13 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 99.12 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 99.02 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 98.96 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 98.95 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 98.95 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 98.94 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 98.93 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 98.93 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 98.93 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 98.93 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 98.92 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 98.92 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 98.89 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 98.87 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 98.87 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 98.86 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 98.85 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 98.83 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 98.82 | |
| 4a27_A | 349 | Synaptic vesicle membrane protein VAT-1 homolog-L; | 98.82 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 98.81 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 98.8 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 98.8 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 98.79 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 98.79 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 98.77 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 98.77 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 98.75 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 98.73 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 98.73 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 98.72 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 98.72 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 98.69 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 98.69 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 98.68 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 98.67 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 98.66 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 98.61 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 98.6 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 98.58 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 98.57 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 98.54 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 98.54 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 98.5 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 98.48 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 98.47 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 98.46 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 98.46 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 98.43 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 98.43 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 98.28 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 98.17 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 98.02 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 97.53 |
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
Probab=99.43 E-value=1.6e-13 Score=81.81 Aligned_cols=67 Identities=18% Similarity=0.288 Sum_probs=56.5
Q ss_pred cccceeEeeeeecccc--cCCCHHHHHHHHHcCCCccccceeeeeehhhHHHHHHHHhcCce-eeEEEee
Q 035170 3 LLNERTLKGTFFGNYK--PRSDLPSVVEKYMSKELEVEKFITHTVPFSEINKAFEYMLRGEG-LRCIIRM 69 (71)
Q Consensus 3 ~~~~~~i~Gs~~g~~~--~~~~~~~~i~l~~~g~~~~~~~it~~~~l~~~~~a~~~~~~~~~-~kvvi~~ 69 (71)
+.|+++++|++.+... +.++++++++++++|+++++++|+++|||+|+++||+.+.+++. +|+||.|
T Consensus 277 ~~k~~~i~G~~~~~~~~~~~~~~~~~~~l~~~g~l~~~~lI~~~~~l~~~~~A~~~l~~~~~~GKvVl~P 346 (346)
T 4a2c_A 277 LRKELTVIGSWMNYSSPWPGQEWETASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP 346 (346)
T ss_dssp HHHTCEEEECCTTCCSSTTCHHHHHHHHHHHTTCSCCGGGEEEEECHHHHHHHHHHHTTSCCCSEEEECC
T ss_pred hhceeEEEEEeccccCcchHHHHHHHHHHHHcCCCCCCccEeEEEeHHHHHHHHHHHHcCCCceEEEEEC
Confidence 4589999999854221 23568999999999999999999999999999999999988764 8999975
|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 71 | ||||
| d1d1ta2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 6e-11 | |
| d1e3ia2 | 174 | c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( | 2e-09 | |
| d2fzwa2 | 176 | c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( | 1e-08 | |
| d2jhfa2 | 176 | c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( | 2e-08 | |
| d1cdoa2 | 175 | c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga | 5e-08 | |
| d1p0fa2 | 174 | c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog | 1e-07 | |
| d1f8fa2 | 174 | c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { | 1e-06 |
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Alcohol dehydrogenase-like, C-terminal domain domain: Alcohol dehydrogenase species: Human (Homo sapiens), different isozymes [TaxId: 9606]
Score = 52.6 bits (125), Expect = 6e-11
Identities = 14/33 (42%), Positives = 20/33 (60%)
Query: 1 MNLLNERTLKGTFFGNYKPRSDLPSVVEKYMSK 33
M L RT KG FG K R D+P +V ++++K
Sbjct: 144 MLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK 176
|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 71 | |||
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 97.49 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 97.43 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 97.31 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 97.29 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 97.27 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 97.08 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 97.01 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 97.0 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 96.68 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.4 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 96.38 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 96.36 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 96.35 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 95.98 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 95.72 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 93.71 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 87.35 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 86.45 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 81.39 |
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Alcohol dehydrogenase-like, C-terminal domain domain: Benzyl alcohol dehydrogenase species: Acinetobacter calcoaceticus [TaxId: 471]
Probab=97.49 E-value=1.1e-05 Score=42.85 Aligned_cols=32 Identities=28% Similarity=0.490 Sum_probs=26.9
Q ss_pred cccceeEeeeeecccccCCCHHHHHHHHHcCC
Q 035170 3 LLNERTLKGTFFGNYKPRSDLPSVVEKYMSKE 34 (71)
Q Consensus 3 ~~~~~~i~Gs~~g~~~~~~~~~~~i~l~~~g~ 34 (71)
++++++++||++|++.++++++++++++++|+
T Consensus 143 ~~k~~~i~Gs~~g~~~~~~~~~~~~~l~~~Gk 174 (174)
T d1f8fa2 143 LLGGKTILGVVEGSGSPKKFIPELVRLYQQGK 174 (174)
T ss_dssp HHTTCEEEECSGGGSCHHHHHHHHHHHHHTTS
T ss_pred HHCCCEEEEEEecCCChHHHHHHHHHHHHcCC
Confidence 46899999999887665578999999999985
|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|