Citrus Sinensis ID: 035225


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70
MATFCSGKTSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTREFRCDRVWVWVDAIGRVSKPPVVG
ccccccccccccccccccHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEEcccccECcccccc
*****SG*TSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTREFRCDRVWVWVDAIGRVSKPPVVG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATFCSGKTSWPELVGEIGAVAAATIKLQNPIVNPIILMLGTPVTREFRCDRVWVWVDAIGRVSKPPVVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Inhibitor of trypsin and hageman factor Specifically inhibits both trypsin and activated Hageman factor.probableP19873
Glu S.griseus protease inhibitor Competitively inhibits Glu S.griseus protease by forming probably a 1:1 complex. BGIA has no inhibitory activity against 2 other acidic amino acid-specific endopeptidases (S.aureus protease V8 and B.subtilis proteinase), chymotrypsin, trypsin, pancreatic elastase, and papain, although subtilisin Carlsberg was strongly inhibited.probableP24076

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DWM, chain A
Confidence level:very confident
Coverage over the Query: 2-70
View the alignment between query and template
View the model in PyMOL