Citrus Sinensis ID: 035282


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MTTSKRLAERKNARFQKNVTRRGSVPESSAKKGSDYPIGPILLGFFVFVVLGSSLFQIIRTATSRGMA
ccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccc
***********************************YPIGPILLGFFVFVVLGSSLFQIIRTATSR***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTSKRLAERKNARFQKNVTRRGSVPESSAKKGSDYPIGPILLGFFVFVVLGSSLFQIIRTATSRGMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable stress-associated endoplasmic reticulum protein May interact with target proteins during translocation into the lumen of the endoplasmic reticulum. May protect unfolded target proteins against degradation and facilitate correct glycosylation.probableQ553P6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted