Citrus Sinensis ID: 035320


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MTTSTFYMYKNERTKLMVLLSILLNQSTFDGNPLATAVAIASLNVIRDEKLAERSRAFEGIHYLEER
cccEEEEEEEHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcc
***STFYMYKNERTKLMVLLSILLNQSTFDGNPLATAVAIASLNVIRDEKLAERSRAFEGIHYLE**
xxxxxxxxxxxxxxxxHHHHHHHxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTSTFYMYKNERTKLMVLLSILLNQSTFDGNPLATAVAIASLNVIRDEKLAERSRAFEGIHYLEER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ornithine aminotransferase probableP07991
Ornithine aminotransferase Catalyzes the interconversion of ornithine to glutamate semialdehyde.probableB9EAM9
Ornithine aminotransferase Catalyzes the interconversion of ornithine to glutamate semialdehyde. Controls arginine catabolism.probableP38021

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RUY, chain A
Confidence level:very confident
Coverage over the Query: 9-63
View the alignment between query and template
View the model in PyMOL