Citrus Sinensis ID: 035393


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50-------
MAGEASMLKFLKPKSRLQPVDVQAAAFWGVAAVSGALYLIQPFDWLKKTFLEKSEEK
cccccccccccccccccccHHHHHHHHHHHHHHHHHHEEEEcHHHHHHHHccccccc
*****************QPVDVQAAAFWGVAAVSGALYLIQPFDWLKKTFL******
xxxxxxxxxxxxxxxxxxxxHHxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGEASMLKFLKPKSRLQPVDVQAAAFWGVAAVSGALYLIQPFDWLKKTFLEKSEEK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquinol-cytochrome c reductase complex 6.7 kDa protein This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.probableP48505

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FYU, chain K
Confidence level:probable
Coverage over the Query: 22-42
View the alignment between query and template
View the model in PyMOL