Citrus Sinensis ID: 035437

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------
MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITKK
cccccHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHEEEEcc
******ATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITKK
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hydrophobic protein LTI6B Plays a role in the regulation of membrane potential. Could mediate a proton leak.confidentQ0DKW8
Hydrophobic protein RCI2B confidentQ9ZNS6
Plasma membrane proteolipid 3 Plays a role in the regulation of membrane potential. Could mediate a proton leak.probableP0CS18

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted