Citrus Sinensis ID: 035508

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
LNTTAVSSNRIHPPSSSNQFIIIANTSSIIRHHRRRDRISLNRNRNMHMEARKYVWEGAIPLQIHLHESEVTTLPPPPPALILAPRIGYLPLLVGLIKPYFGSSLPPGVDTIWFEYKGLPLKWYTPTGVLFDLLCAEPERPWNLTVHFRGYPVHVLIPCEGEDSVKWSFINSLKEAAYIINGNCKNVMNMSQSDQVELWRSVMNGNLEAYLRVSSKLKLITVEDDYTVKLNSSSKSQQGTGETDFAGQVKTGRIPVRLYVWSVSEDFDDLEDAPDIDCWDKISFINRPVEVRTEEGKCFTLRDAIKTLLPEYFTDKPLFNDESPKLEDEEMNLSSEDAGSNKNTEVEEILYEHVTRNAEIKLVRIQGIEPKLEIPFSWV
cccccccccccccccccccEEEEEcccHHHHccccccccccccccccHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccHHHHHHHHHHHHHccccccccccEEEEEcccccccccccHHHHHHcccccccccEEEEECcccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccEEcccccccccccccccHHHHHHHHccccccccccccccccccccHcccccccccccccccHHHHHHHHHHcccccccEEEEECcccccccccccc
*************PSSSNQFIIIANTSSIIRHHRRRDRISLNRNRNMHMEARKYVWEGAIPLQIHLHESE*TTLPPPPPALILAPRIGYLPLLVGLIKPYFGSSLPPGVDTIWFEYKGLPLKWYTPTGVLFDLLCAEPERPWNLTVHFRGYPVHVLIPCEGEDSVKWSFINSLKEAAYIINGNCKNVMNMSQSDQVELWRSVMNGNLEAYLRVSSKLKLI***************************QVKTGRIPVRLYVWSVSED***********CWDKISFINRPVEVRTEEGKCFTLRDAIKTLLPEYFTDKP*********************************YEHVTRNAEIKLVRIQGIEPKLEIPFSWV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LNTTAVSSNRIHPPSSSNQFIIIANTSSIIRHHRRRDRISLNRNRNMHMEARKYVWEGAIPLQIHLHESEVTTLPPPPPALILAPRIGYLPLLVGLIKPYFGSSLPPGVDTIWFEYKGLPLKWYTPTGVLFDLLCAEPERPWNLTVHFRGYPVHVLIPCEGEDSVKWSFINSLKEAAYIINGNCKNVMNMSQSDQVELWRSVMNGNLEAYLRVSSKLKLITVEDDYTVKLNSSSKSQQGTGETDFAGQVKTGRIPVRLYVWSVSEDFDDLEDAPDIDCWDKISFINRPVEVRTEEGKCFTLRDAIKTLLPEYFTDKPLFNDESPKLEDEEMNLSSEDAGSNKNTEVEEILYEHVTRNAEIKLVRIQGIEPKLEIPFSWV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Autophagy protein 5 Required for autophagy. Conjugation to ATG12 is essential for plant nutrient recycling.probableQ9FFI2
Autophagy protein 5 Required for autophagy. Conjugation to ATG12 is essential for plant nutrient recycling.probableQ6ZGL4
Autophagy protein 5 Required for autophagy. Conjugation to ATG12 is essential for plant nutrient recycling.probableA2X052

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VQI, chain A
Confidence level:very confident
Coverage over the Query: 47-220,249-263,283-321,361-379
View the alignment between query and template
View the model in PyMOL