Citrus Sinensis ID: 035557
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| 242199344 | 468 | UDP-glucosyltransferase family 1 protein | 1.0 | 0.275 | 0.922 | 4e-66 | |
| 224129334 | 459 | predicted protein [Populus trichocarpa] | 0.984 | 0.276 | 0.692 | 7e-46 | |
| 147795321 | 431 | hypothetical protein VITISV_008681 [Viti | 0.976 | 0.292 | 0.650 | 9e-46 | |
| 359478282 | 454 | PREDICTED: UDP-glycosyltransferase 74E2- | 0.976 | 0.277 | 0.650 | 1e-45 | |
| 296084334 | 429 | unnamed protein product [Vitis vinifera] | 0.976 | 0.293 | 0.650 | 1e-45 | |
| 147787911 | 433 | hypothetical protein VITISV_002845 [Viti | 0.930 | 0.277 | 0.658 | 2e-45 | |
| 255583381 | 458 | UDP-glucosyltransferase, putative [Ricin | 0.922 | 0.259 | 0.680 | 2e-44 | |
| 225434164 | 457 | PREDICTED: UDP-glycosyltransferase 74F2 | 0.976 | 0.275 | 0.642 | 3e-44 | |
| 225434168 | 458 | PREDICTED: UDP-glycosyltransferase 74F2 | 0.968 | 0.272 | 0.648 | 3e-44 | |
| 296084327 | 388 | unnamed protein product [Vitis vinifera] | 0.976 | 0.324 | 0.642 | 4e-44 |
| >gi|242199344|gb|ACS87993.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 255 bits (651), Expect = 4e-66, Method: Composition-based stats.
Identities = 119/129 (92%), Positives = 124/129 (96%)
Query: 1 NWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGL 60
NWCPQLEVLAHEATGCFLTHCGWNSTMEA SLGVPMVAMPQW+DQSTN+K +MDVWKTGL
Sbjct: 340 NWCPQLEVLAHEATGCFLTHCGWNSTMEALSLGVPMVAMPQWSDQSTNAKYIMDVWKTGL 399
Query: 61 KVPADDKGIVRREAIAHCIREILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFV 120
KVPAD+KGIVRREAIAHCIREILEGER KEIRQNAG+WSNFAKEAV KGGSSDKNIDDFV
Sbjct: 400 KVPADEKGIVRREAIAHCIREILEGERGKEIRQNAGEWSNFAKEAVAKGGSSDKNIDDFV 459
Query: 121 ANSISSKSF 129
AN ISSKSF
Sbjct: 460 ANLISSKSF 468
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224129334|ref|XP_002320558.1| predicted protein [Populus trichocarpa] gi|222861331|gb|EEE98873.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147795321|emb|CAN67246.1| hypothetical protein VITISV_008681 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359478282|ref|XP_002275333.2| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296084334|emb|CBI24722.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147787911|emb|CAN69453.1| hypothetical protein VITISV_002845 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255583381|ref|XP_002532451.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223527841|gb|EEF29937.1| UDP-glucosyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|225434164|ref|XP_002278455.1| PREDICTED: UDP-glycosyltransferase 74F2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225434168|ref|XP_002275170.1| PREDICTED: UDP-glycosyltransferase 74F2 [Vitis vinifera] gi|147815573|emb|CAN68287.1| hypothetical protein VITISV_017016 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296084327|emb|CBI24715.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| TAIR|locus:2031983 | 453 | UGT74E2 "AT1G05680" [Arabidops | 0.937 | 0.267 | 0.611 | 3.3e-40 | |
| TAIR|locus:2045268 | 457 | AT2G31790 [Arabidopsis thalian | 0.930 | 0.262 | 0.625 | 1.8e-39 | |
| TAIR|locus:2044044 | 449 | UGT74F1 "UDP-glycosyltransfera | 0.930 | 0.267 | 0.578 | 3.4e-38 | |
| TAIR|locus:2043949 | 449 | UGT74F2 "UDP-glucosyltransfera | 0.968 | 0.278 | 0.559 | 2.4e-37 | |
| TAIR|locus:2045238 | 456 | UGT74D1 "UDP-glucosyl transfer | 0.961 | 0.271 | 0.555 | 6.3e-37 | |
| TAIR|locus:2032387 | 460 | UGT74B1 "UDP-glucosyl transfer | 0.930 | 0.260 | 0.504 | 3.2e-33 | |
| TAIR|locus:2201031 | 469 | UGT75B1 "UDP-glucosyltransfera | 0.922 | 0.253 | 0.516 | 6.7e-33 | |
| TAIR|locus:2201066 | 455 | UGT75B2 "UDP-glucosyl transfer | 0.922 | 0.261 | 0.5 | 1.8e-32 | |
| TAIR|locus:2089880 | 496 | UGT84A2 "UDP-glucosyl transfer | 0.922 | 0.239 | 0.495 | 1.7e-30 | |
| TAIR|locus:2130225 | 475 | UGT84A4 "AT4G15500" [Arabidops | 0.984 | 0.267 | 0.480 | 3.8e-30 |
| TAIR|locus:2031983 UGT74E2 "AT1G05680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 428 (155.7 bits), Expect = 3.3e-40, P = 3.3e-40
Identities = 74/121 (61%), Positives = 97/121 (80%)
Query: 1 NWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGL 60
+W PQL+VLAH++ GCFLTHCGWNST+E SLGVPM+ MP WTDQ TN+K + DVWK G+
Sbjct: 330 SWSPQLDVLAHKSIGCFLTHCGWNSTLEGLSLGVPMIGMPHWTDQPTNAKFMQDVWKVGV 389
Query: 61 KVPADDKGIVRREAIAHCIREILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFV 120
+V A+ G VRRE I + E++EGE+ KEIR+NA KW A+EAV++GGSSDK+I++FV
Sbjct: 390 RVKAEGDGFVRREEIMRSVEEVMEGEKGKEIRKNAEKWKVLAQEAVSEGGSSDKSINEFV 449
Query: 121 A 121
+
Sbjct: 450 S 450
|
|
| TAIR|locus:2045268 AT2G31790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044044 UGT74F1 "UDP-glycosyltransferase 74 F1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043949 UGT74F2 "UDP-glucosyltransferase 74F2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2045238 UGT74D1 "UDP-glucosyl transferase 74D1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032387 UGT74B1 "UDP-glucosyl transferase 74B1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201031 UGT75B1 "UDP-glucosyltransferase 75B1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201066 UGT75B2 "UDP-glucosyl transferase 75B2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089880 UGT84A2 "UDP-glucosyl transferase 84A2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130225 UGT84A4 "AT4G15500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| PLN02173 | 449 | PLN02173, PLN02173, UDP-glucosyl transferase famil | 1e-53 | |
| PLN02555 | 480 | PLN02555, PLN02555, limonoid glucosyltransferase | 8e-48 | |
| PLN02152 | 455 | PLN02152, PLN02152, indole-3-acetate beta-glucosyl | 8e-43 | |
| PLN02448 | 459 | PLN02448, PLN02448, UDP-glycosyltransferase family | 2e-38 | |
| PLN02210 | 456 | PLN02210, PLN02210, UDP-glucosyl transferase | 1e-30 | |
| PLN03007 | 482 | PLN03007, PLN03007, UDP-glucosyltransferase family | 4e-29 | |
| PLN02410 | 451 | PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl | 3e-24 | |
| PLN02863 | 477 | PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl | 3e-23 | |
| PLN02167 | 475 | PLN02167, PLN02167, UDP-glycosyltransferase family | 2e-22 | |
| PLN02992 | 481 | PLN02992, PLN02992, coniferyl-alcohol glucosyltran | 9e-22 | |
| PLN02534 | 491 | PLN02534, PLN02534, UDP-glycosyltransferase | 7e-21 | |
| PLN03004 | 451 | PLN03004, PLN03004, UDP-glycosyltransferase | 8e-19 | |
| PLN02562 | 448 | PLN02562, PLN02562, UDP-glycosyltransferase | 9e-19 | |
| PLN02207 | 468 | PLN02207, PLN02207, UDP-glycosyltransferase | 1e-18 | |
| PLN00164 | 480 | PLN00164, PLN00164, glucosyltransferase; Provision | 2e-18 | |
| PLN03015 | 470 | PLN03015, PLN03015, UDP-glucosyl transferase | 7e-18 | |
| PLN02554 | 481 | PLN02554, PLN02554, UDP-glycosyltransferase family | 2e-16 | |
| pfam00201 | 500 | pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy | 9e-16 | |
| PLN02670 | 472 | PLN02670, PLN02670, transferase, transferring glyc | 1e-15 | |
| TIGR01426 | 392 | TIGR01426, MGT, glycosyltransferase, MGT family | 1e-13 | |
| cd03784 | 401 | cd03784, GT1_Gtf_like, This family includes the Gt | 2e-13 | |
| PLN02764 | 453 | PLN02764, PLN02764, glycosyltransferase family pro | 4e-12 | |
| COG1819 | 406 | COG1819, COG1819, Glycosyl transferases, related t | 2e-11 | |
| PLN02208 | 442 | PLN02208, PLN02208, glycosyltransferase family pro | 2e-09 | |
| PLN00414 | 446 | PLN00414, PLN00414, glycosyltransferase family pro | 7e-09 | |
| PHA03392 | 507 | PHA03392, egt, ecdysteroid UDP-glucosyltransferase | 8e-07 | |
| cd03801 | 374 | cd03801, GT1_YqgM_like, This family is most closel | 3e-04 | |
| cd03799 | 355 | cd03799, GT1_amsK_like, This is a family of GT1 gl | 4e-04 |
| >gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
Score = 173 bits (440), Expect = 1e-53
Identities = 70/121 (57%), Positives = 98/121 (80%), Gaps = 1/121 (0%)
Query: 2 WCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGLK 61
W PQL+VL+++A GCF+THCGWNSTME SLGVPMVAMPQWTDQ N+K + DVWK G++
Sbjct: 324 WSPQLQVLSNKAIGCFMTHCGWNSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVR 383
Query: 62 VPAD-DKGIVRREAIAHCIREILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFV 120
V A+ + GI +RE I I+E++EGE+ KE+++NAGKW + A +++++GGS+D NI+ FV
Sbjct: 384 VKAEKESGIAKREEIEFSIKEVMEGEKSKEMKENAGKWRDLAVKSLSEGGSTDININTFV 443
Query: 121 A 121
+
Sbjct: 444 S 444
|
Length = 449 |
| >gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family | Back alignment and domain information |
|---|
| >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|177858 PLN02208, PLN02208, glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|177807 PLN00414, PLN00414, glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >gnl|CDD|99972 cd03799, GT1_amsK_like, This is a family of GT1 glycosyltransferases found specifically in certain bacteria | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| PLN02210 | 456 | UDP-glucosyl transferase | 100.0 | |
| PLN02555 | 480 | limonoid glucosyltransferase | 100.0 | |
| PLN02410 | 451 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 100.0 | |
| PLN02173 | 449 | UDP-glucosyl transferase family protein | 100.0 | |
| PLN02207 | 468 | UDP-glycosyltransferase | 100.0 | |
| PLN03007 | 482 | UDP-glucosyltransferase family protein | 100.0 | |
| PLN02554 | 481 | UDP-glycosyltransferase family protein | 100.0 | |
| PLN00164 | 480 | glucosyltransferase; Provisional | 100.0 | |
| PLN02448 | 459 | UDP-glycosyltransferase family protein | 100.0 | |
| PLN02152 | 455 | indole-3-acetate beta-glucosyltransferase | 100.0 | |
| PLN02992 | 481 | coniferyl-alcohol glucosyltransferase | 100.0 | |
| PLN02534 | 491 | UDP-glycosyltransferase | 100.0 | |
| PLN02167 | 475 | UDP-glycosyltransferase family protein | 100.0 | |
| PLN03015 | 470 | UDP-glucosyl transferase | 100.0 | |
| PLN02208 | 442 | glycosyltransferase family protein | 100.0 | |
| PLN02863 | 477 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 100.0 | |
| PLN02562 | 448 | UDP-glycosyltransferase | 99.97 | |
| PLN02764 | 453 | glycosyltransferase family protein | 99.97 | |
| PLN02670 | 472 | transferase, transferring glycosyl groups | 99.97 | |
| PLN03004 | 451 | UDP-glycosyltransferase | 99.97 | |
| PLN00414 | 446 | glycosyltransferase family protein | 99.97 | |
| PF00201 | 500 | UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera | 99.96 | |
| PHA03392 | 507 | egt ecdysteroid UDP-glucosyltransferase; Provision | 99.95 | |
| KOG1192 | 496 | consensus UDP-glucuronosyl and UDP-glucosyl transf | 99.92 | |
| COG1819 | 406 | Glycosyl transferases, related to UDP-glucuronosyl | 99.9 | |
| TIGR01426 | 392 | MGT glycosyltransferase, MGT family. This model de | 99.87 | |
| cd03784 | 401 | GT1_Gtf_like This family includes the Gtfs, a grou | 99.85 | |
| PF04101 | 167 | Glyco_tran_28_C: Glycosyltransferase family 28 C-t | 99.56 | |
| PRK12446 | 352 | undecaprenyldiphospho-muramoylpentapeptide beta-N- | 99.53 | |
| COG0707 | 357 | MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami | 99.46 | |
| PF13528 | 318 | Glyco_trans_1_3: Glycosyl transferase family 1 | 99.41 | |
| TIGR00661 | 321 | MJ1255 conserved hypothetical protein. This model | 99.39 | |
| PRK00726 | 357 | murG undecaprenyldiphospho-muramoylpentapeptide be | 99.37 | |
| TIGR01133 | 348 | murG undecaprenyldiphospho-muramoylpentapeptide be | 99.08 | |
| cd03785 | 350 | GT1_MurG MurG is an N-acetylglucosaminyltransferas | 99.06 | |
| PRK13608 | 391 | diacylglycerol glucosyltransferase; Provisional | 99.01 | |
| PLN02605 | 382 | monogalactosyldiacylglycerol synthase | 98.92 | |
| TIGR00215 | 385 | lpxB lipid-A-disaccharide synthase. Lipid-A precur | 98.88 | |
| PRK13609 | 380 | diacylglycerol glucosyltransferase; Provisional | 98.86 | |
| TIGR03492 | 396 | conserved hypothetical protein. This protein famil | 98.82 | |
| PRK00025 | 380 | lpxB lipid-A-disaccharide synthase; Reviewed | 98.7 | |
| COG4671 | 400 | Predicted glycosyl transferase [General function p | 98.57 | |
| TIGR03590 | 279 | PseG pseudaminic acid biosynthesis-associated prot | 98.41 | |
| KOG3349 | 170 | consensus Predicted glycosyltransferase [General f | 98.35 | |
| PRK14089 | 347 | ipid-A-disaccharide synthase; Provisional | 98.27 | |
| cd03814 | 364 | GT1_like_2 This family is most closely related to | 98.25 | |
| TIGR00236 | 365 | wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras | 98.01 | |
| PRK05749 | 425 | 3-deoxy-D-manno-octulosonic-acid transferase; Revi | 97.91 | |
| cd03801 | 374 | GT1_YqgM_like This family is most closely related | 97.77 | |
| PRK15484 | 380 | lipopolysaccharide 1,2-N-acetylglucosaminetransfer | 97.77 | |
| cd05844 | 367 | GT1_like_7 Glycosyltransferases catalyze the trans | 97.76 | |
| PF00534 | 172 | Glycos_transf_1: Glycosyl transferases group 1; In | 97.75 | |
| cd03823 | 359 | GT1_ExpE7_like This family is most closely related | 97.73 | |
| cd03820 | 348 | GT1_amsD_like This family is most closely related | 97.73 | |
| cd03795 | 357 | GT1_like_4 This family is most closely related to | 97.73 | |
| cd03800 | 398 | GT1_Sucrose_synthase This family is most closely r | 97.68 | |
| cd03822 | 366 | GT1_ecORF704_like This family is most closely rela | 97.62 | |
| cd03798 | 377 | GT1_wlbH_like This family is most closely related | 97.61 | |
| PRK15427 | 406 | colanic acid biosynthesis glycosyltransferase WcaL | 97.6 | |
| cd03817 | 374 | GT1_UGDG_like This family is most closely related | 97.58 | |
| cd03808 | 359 | GT1_cap1E_like This family is most closely related | 97.57 | |
| cd03807 | 365 | GT1_WbnK_like This family is most closely related | 97.57 | |
| cd04946 | 407 | GT1_AmsK_like This family is most closely related | 97.53 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 97.48 | |
| cd04962 | 371 | GT1_like_5 This family is most closely related to | 97.47 | |
| cd04949 | 372 | GT1_gtfA_like This family is most closely related | 97.43 | |
| COG5017 | 161 | Uncharacterized conserved protein [Function unknow | 97.42 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 97.41 | |
| TIGR03088 | 374 | stp2 sugar transferase, PEP-CTERM/EpsH1 system ass | 97.39 | |
| cd03825 | 365 | GT1_wcfI_like This family is most closely related | 97.36 | |
| PF13844 | 468 | Glyco_transf_41: Glycosyl transferase family 41; P | 97.36 | |
| cd03821 | 375 | GT1_Bme6_like This family is most closely related | 97.33 | |
| cd03794 | 394 | GT1_wbuB_like This family is most closely related | 97.33 | |
| TIGR03449 | 405 | mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino | 97.31 | |
| cd03816 | 415 | GT1_ALG1_like This family is most closely related | 97.29 | |
| cd03818 | 396 | GT1_ExpC_like This family is most closely related | 97.29 | |
| PRK10307 | 412 | putative glycosyl transferase; Provisional | 97.28 | |
| TIGR02149 | 388 | glgA_Coryne glycogen synthase, Corynebacterium fam | 97.24 | |
| cd03799 | 355 | GT1_amsK_like This is a family of GT1 glycosyltran | 97.22 | |
| TIGR03087 | 397 | stp1 sugar transferase, PEP-CTERM/EpsH1 system ass | 97.2 | |
| PRK09814 | 333 | beta-1,6-galactofuranosyltransferase; Provisional | 97.16 | |
| PRK09922 | 359 | UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D | 97.13 | |
| COG1519 | 419 | KdtA 3-deoxy-D-manno-octulosonic-acid transferase | 97.1 | |
| COG3980 | 318 | spsG Spore coat polysaccharide biosynthesis protei | 97.1 | |
| TIGR02472 | 439 | sucr_P_syn_N sucrose-phosphate synthase, putative, | 97.09 | |
| cd03804 | 351 | GT1_wbaZ_like This family is most closely related | 97.09 | |
| cd04951 | 360 | GT1_WbdM_like This family is most closely related | 97.03 | |
| TIGR02918 | 500 | accessory Sec system glycosylation protein GtfA. M | 96.98 | |
| PF13524 | 92 | Glyco_trans_1_2: Glycosyl transferases group 1 | 96.9 | |
| cd03805 | 392 | GT1_ALG2_like This family is most closely related | 96.86 | |
| cd03809 | 365 | GT1_mtfB_like This family is most closely related | 96.82 | |
| cd03819 | 355 | GT1_WavL_like This family is most closely related | 96.77 | |
| cd03811 | 353 | GT1_WabH_like This family is most closely related | 96.66 | |
| cd03813 | 475 | GT1_like_3 This family is most closely related to | 96.65 | |
| PRK10017 | 426 | colanic acid biosynthesis protein; Provisional | 96.54 | |
| cd03812 | 358 | GT1_CapH_like This family is most closely related | 96.38 | |
| PHA01630 | 331 | putative group 1 glycosyl transferase | 96.29 | |
| PF02350 | 346 | Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; | 96.25 | |
| PF13692 | 135 | Glyco_trans_1_4: Glycosyl transferases group 1; PD | 96.25 | |
| PLN02275 | 371 | transferase, transferring glycosyl groups | 96.13 | |
| cd03792 | 372 | GT1_Trehalose_phosphorylase Trehalose phosphorylas | 96.11 | |
| TIGR02400 | 456 | trehalose_OtsA alpha,alpha-trehalose-phosphate syn | 96.07 | |
| PF02684 | 373 | LpxB: Lipid-A-disaccharide synthetase; InterPro: I | 96.01 | |
| COG0381 | 383 | WecB UDP-N-acetylglucosamine 2-epimerase [Cell env | 95.97 | |
| PHA01633 | 335 | putative glycosyl transferase group 1 | 95.9 | |
| cd03796 | 398 | GT1_PIG-A_like This family is most closely related | 95.88 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 95.84 | |
| PRK01021 | 608 | lpxB lipid-A-disaccharide synthase; Reviewed | 95.61 | |
| cd04955 | 363 | GT1_like_6 This family is most closely related to | 95.57 | |
| cd03791 | 476 | GT1_Glycogen_synthase_DULL1_like This family is mo | 95.27 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 95.2 | |
| PRK15490 | 578 | Vi polysaccharide biosynthesis protein TviE; Provi | 95.14 | |
| PLN02949 | 463 | transferase, transferring glycosyl groups | 94.82 | |
| TIGR02095 | 473 | glgA glycogen/starch synthases, ADP-glucose type. | 94.55 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 94.49 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 94.44 | |
| PRK10125 | 405 | putative glycosyl transferase; Provisional | 94.34 | |
| COG4370 | 412 | Uncharacterized protein conserved in bacteria [Fun | 94.31 | |
| cd04950 | 373 | GT1_like_1 Glycosyltransferases catalyze the trans | 94.29 | |
| cd03802 | 335 | GT1_AviGT4_like This family is most closely relate | 93.9 | |
| PRK14098 | 489 | glycogen synthase; Provisional | 93.82 | |
| TIGR02919 | 438 | accessory Sec system glycosyltransferase GtfB. Mem | 93.64 | |
| PRK00654 | 466 | glgA glycogen synthase; Provisional | 93.56 | |
| PLN00142 | 815 | sucrose synthase | 93.22 | |
| PF04464 | 369 | Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate | 92.95 | |
| cd03788 | 460 | GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a | 92.85 | |
| COG0763 | 381 | LpxB Lipid A disaccharide synthetase [Cell envelop | 92.83 | |
| TIGR02470 | 784 | sucr_synth sucrose synthase. This model represents | 92.79 | |
| TIGR03568 | 365 | NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, | 92.77 | |
| TIGR03713 | 519 | acc_sec_asp1 accessory Sec system protein Asp1. Th | 92.57 | |
| PF04007 | 335 | DUF354: Protein of unknown function (DUF354); Inte | 92.24 | |
| PLN02846 | 462 | digalactosyldiacylglycerol synthase | 91.85 | |
| cd03793 | 590 | GT1_Glycogen_synthase_GSY2_like Glycogen synthase, | 91.57 | |
| cd03806 | 419 | GT1_ALG11_like This family is most closely related | 91.22 | |
| PLN02501 | 794 | digalactosyldiacylglycerol synthase | 91.15 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 90.72 | |
| cd01635 | 229 | Glycosyltransferase_GTB_type Glycosyltransferases | 89.65 | |
| PLN02316 | 1036 | synthase/transferase | 89.41 | |
| PF06506 | 176 | PrpR_N: Propionate catabolism activator; InterPro: | 89.2 | |
| PRK04885 | 265 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 88.95 | |
| PF06258 | 311 | Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP | 88.21 | |
| PRK02155 | 291 | ppnK NAD(+)/NADH kinase family protein; Provisiona | 87.84 | |
| PRK14077 | 287 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 87.73 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 87.63 | |
| PRK01911 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 87.16 | |
| PRK02649 | 305 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 86.94 | |
| PRK14501 | 726 | putative bifunctional trehalose-6-phosphate syntha | 86.45 | |
| PRK04539 | 296 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 86.03 | |
| PRK03378 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 85.3 | |
| PRK02231 | 272 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 84.58 | |
| PLN02935 | 508 | Bifunctional NADH kinase/NAD(+) kinase | 83.73 | |
| PRK03372 | 306 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 83.54 | |
| PF05693 | 633 | Glycogen_syn: Glycogen synthase; InterPro: IPR0086 | 83.39 | |
| PRK01231 | 295 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 81.72 | |
| PRK01185 | 271 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 81.34 | |
| PRK14075 | 256 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 80.46 |
| >PLN02210 UDP-glucosyl transferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-34 Score=222.56 Aligned_cols=124 Identities=40% Similarity=0.819 Sum_probs=115.7
Q ss_pred CCCChHHhhcccCCcceecCCChhhHHHHHHcCCCeecccccccchhhHHHHHHHhcccceecCCC-CCCccHHHHHHHH
Q 035557 1 NWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGLKVPADD-KGIVRREAIAHCI 79 (129)
Q Consensus 1 ~w~pq~~iL~~~~~~~~I~hgG~~s~~eal~~gvP~i~~P~~~dq~~na~~~~~~~g~g~~~~~~~-~~~~~~~~l~~~i 79 (129)
+|+||..||+|+++++|||||||||++|++++|||||++|++.||+.||+++++.||+|+.+...+ ++.+++++|.++|
T Consensus 330 ~w~PQ~~iL~h~~vg~FitH~G~nS~~Eai~~GVP~v~~P~~~DQ~~na~~~~~~~g~G~~l~~~~~~~~~~~~~l~~av 409 (456)
T PLN02210 330 EWSPQEKILSHMAISCFVTHCGWNSTIETVVAGVPVVAYPSWTDQPIDARLLVDVFGIGVRMRNDAVDGELKVEEVERCI 409 (456)
T ss_pred ecCCHHHHhcCcCcCeEEeeCCcccHHHHHHcCCCEEecccccccHHHHHHHHHHhCeEEEEeccccCCcCCHHHHHHHH
Confidence 599999999999999999999999999999999999999999999999999999669999986431 2368999999999
Q ss_pred HHHHhChhhHHHHHHHHHHHHHHHHHhhcCCChHHHHHHHHHHHh
Q 035557 80 REILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFVANSI 124 (129)
Q Consensus 80 ~~~l~~~~~~~~~~~a~~l~~~~~~~~~~~g~~~~~~~~~~~~l~ 124 (129)
+++|.+++|+++|+|+++|++.+++++++||||..++++|+++++
T Consensus 410 ~~~m~~~~g~~~r~~a~~l~~~a~~Av~~gGSS~~~l~~~v~~~~ 454 (456)
T PLN02210 410 EAVTEGPAAADIRRRAAELKHVARLALAPGGSSARNLDLFISDIT 454 (456)
T ss_pred HHHhcCchHHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHh
Confidence 999988878899999999999999999999999999999999875
|
|
| >PLN02555 limonoid glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02173 UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02207 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN03007 UDP-glucosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02554 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN00164 glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02448 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02152 indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02992 coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02534 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02167 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN03015 UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >PLN02208 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02562 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02764 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02670 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PLN03004 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN00414 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule | Back alignment and domain information |
|---|
| >PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01426 MGT glycosyltransferase, MGT family | Back alignment and domain information |
|---|
| >cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 | Back alignment and domain information |
|---|
| >TIGR00661 MJ1255 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis | Back alignment and domain information |
|---|
| >PRK13608 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02605 monogalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >TIGR00215 lpxB lipid-A-disaccharide synthase | Back alignment and domain information |
|---|
| >PRK13609 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03492 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >COG4671 Predicted glycosyl transferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG | Back alignment and domain information |
|---|
| >KOG3349 consensus Predicted glycosyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14089 ipid-A-disaccharide synthase; Provisional | Back alignment and domain information |
|---|
| >cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase | Back alignment and domain information |
|---|
| >PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed | Back alignment and domain information |
|---|
| >cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional | Back alignment and domain information |
|---|
| >cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional | Back alignment and domain information |
|---|
| >cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding | Back alignment and domain information |
|---|
| >COG5017 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A | Back alignment and domain information |
|---|
| >cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK10307 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family | Back alignment and domain information |
|---|
| >cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria | Back alignment and domain information |
|---|
| >TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >PRK09814 beta-1,6-galactofuranosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain | Back alignment and domain information |
|---|
| >cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli | Back alignment and domain information |
|---|
| >TIGR02918 accessory Sec system glycosylation protein GtfA | Back alignment and domain information |
|---|
| >PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK10017 colanic acid biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PHA01630 putative group 1 glycosyl transferase | Back alignment and domain information |
|---|
| >PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 | Back alignment and domain information |
|---|
| >PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A | Back alignment and domain information |
|---|
| >PLN02275 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose | Back alignment and domain information |
|---|
| >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PHA01633 putative glycosyl transferase group 1 | Back alignment and domain information |
|---|
| >cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PLN02949 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >TIGR02095 glgA glycogen/starch synthases, ADP-glucose type | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10125 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >COG4370 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK14098 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02919 accessory Sec system glycosyltransferase GtfB | Back alignment and domain information |
|---|
| >PRK00654 glgA glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >PLN00142 sucrose synthase | Back alignment and domain information |
|---|
| >PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria | Back alignment and domain information |
|---|
| >cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor | Back alignment and domain information |
|---|
| >COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02470 sucr_synth sucrose synthase | Back alignment and domain information |
|---|
| >TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing | Back alignment and domain information |
|---|
| >TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 | Back alignment and domain information |
|---|
| >PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length | Back alignment and domain information |
|---|
| >PLN02846 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis | Back alignment and domain information |
|---|
| >cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02501 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional | Back alignment and domain information |
|---|
| >PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02935 Bifunctional NADH kinase/NAD(+) kinase | Back alignment and domain information |
|---|
| >PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 | Back alignment and domain information |
|---|
| >PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 129 | ||||
| 2vce_A | 480 | Characterization And Engineering Of The Bifunctiona | 6e-22 | ||
| 2pq6_A | 482 | Crystal Structure Of Medicago Truncatula Ugt85h2- I | 1e-21 | ||
| 2c1x_A | 456 | Structure And Activity Of A Flavonoid 3-O Glucosylt | 7e-21 | ||
| 2acw_A | 465 | Crystal Structure Of Medicago Truncatula Ugt71g1 Co | 4e-16 | ||
| 3hbf_A | 454 | Structure Of Ugt78g1 Complexed With Myricetin And U | 5e-16 | ||
| 2acv_A | 463 | Crystal Structure Of Medicago Truncatula Ugt71g1 Le | 6e-16 | ||
| 2iya_A | 424 | The Crystal Structure Of Macrolide Glycosyltransfer | 9e-10 | ||
| 2o6l_A | 170 | Crystal Structure Of The Udp-Glucuronic Acid Bindin | 5e-07 | ||
| 2iyf_A | 430 | The Crystal Structure Of Macrolide Glycosyltransfer | 1e-04 |
| >pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 | Back alignment and structure |
|
| >pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 | Back alignment and structure |
| >pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 | Back alignment and structure |
| >pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 | Back alignment and structure |
| >pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 | Back alignment and structure |
| >pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 | Back alignment and structure |
| >pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 | Back alignment and structure |
| >pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 | Back alignment and structure |
| >pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 1e-69 | |
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 3e-69 | |
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 9e-67 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 2e-64 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 4e-59 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 6e-18 | |
| 2iya_A | 424 | OLEI, oleandomycin glycosyltransferase; carbohydra | 1e-17 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 5e-17 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 1e-15 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 5e-15 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 7e-15 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 1e-14 | |
| 2p6p_A | 384 | Glycosyl transferase; X-RAY-diffraction,urdamycina | 3e-14 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 3e-14 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 3e-13 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 4e-12 | |
| 1iir_A | 415 | Glycosyltransferase GTFB; rossmann fold; 1.80A {Am | 8e-11 | |
| 3h4t_A | 404 | Glycosyltransferase GTFA, glycosyltransferase; van | 9e-11 | |
| 1rrv_A | 416 | Glycosyltransferase GTFD; GT-B, glycosyltransferas | 2e-09 |
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 | Back alignment and structure |
|---|
Score = 215 bits (549), Expect = 1e-69
Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 3/119 (2%)
Query: 2 WCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGLK 61
W PQ EVLAHEA G F+THCGWNS E+ + GVP++ P + DQ N + V DV + G++
Sbjct: 332 WAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVR 391
Query: 62 VPADDKGIVRREAIAHCIREILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFV 120
+ + G+ + + C +IL E+ K++R+N A AV GSS +N V
Sbjct: 392 I---EGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLV 447
|
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 | Back alignment and structure |
|---|
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 | Back alignment and structure |
|---|
| >2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 | Back alignment and structure |
|---|
| >1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 | Back alignment and structure |
|---|
| >3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} PDB: 3h4i_A* 1pn3_A* 1pnv_A* Length = 404 | Back alignment and structure |
|---|
| >1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 100.0 | |
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 100.0 | |
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 99.98 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 99.97 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 99.97 | |
| 4amg_A | 400 | Snogd; transferase, polyketide biosynthesis, GT1 f | 99.91 | |
| 2iya_A | 424 | OLEI, oleandomycin glycosyltransferase; carbohydra | 99.88 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 99.87 | |
| 1iir_A | 415 | Glycosyltransferase GTFB; rossmann fold; 1.80A {Am | 99.86 | |
| 2p6p_A | 384 | Glycosyl transferase; X-RAY-diffraction,urdamycina | 99.86 | |
| 1rrv_A | 416 | Glycosyltransferase GTFD; GT-B, glycosyltransferas | 99.85 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 99.85 | |
| 3h4t_A | 404 | Glycosyltransferase GTFA, glycosyltransferase; van | 99.85 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 99.83 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 99.81 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 99.8 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 99.8 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 99.79 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 99.77 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 99.73 | |
| 3s2u_A | 365 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape | 99.66 | |
| 2jzc_A | 224 | UDP-N-acetylglucosamine transferase subunit ALG13; | 99.41 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 99.19 | |
| 3hbm_A | 282 | UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je | 98.83 | |
| 1v4v_A | 376 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t | 98.33 | |
| 3ot5_A | 403 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 98.18 | |
| 1vgv_A | 384 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 98.07 | |
| 2f9f_A | 177 | First mannosyl transferase (WBAZ-1); alpha-beta pr | 97.98 | |
| 3dzc_A | 396 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 97.97 | |
| 2iw1_A | 374 | Lipopolysaccharide core biosynthesis protein RFAG; | 97.96 | |
| 3c48_A | 438 | Predicted glycosyltransferases; retaining glycosyl | 97.93 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 97.93 | |
| 4hwg_A | 385 | UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc | 97.82 | |
| 3beo_A | 375 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a | 97.81 | |
| 3okp_A | 394 | GDP-mannose-dependent alpha-(1-6)-phosphatidylino | 97.72 | |
| 2jjm_A | 394 | Glycosyl transferase, group 1 family protein; anth | 97.71 | |
| 2xci_A | 374 | KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci | 97.62 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.56 | |
| 2bfw_A | 200 | GLGA glycogen synthase; glycosyltransferase family | 97.56 | |
| 2x6q_A | 416 | Trehalose-synthase TRET; biosynthetic protein; 2.2 | 97.51 | |
| 2iuy_A | 342 | Avigt4, glycosyltransferase; antibiotics, family G | 97.41 | |
| 3fro_A | 439 | GLGA glycogen synthase; glycosyltransferase family | 97.36 | |
| 3rhz_A | 339 | GTF3, nucleotide sugar synthetase-like protein; gl | 97.3 | |
| 3oy2_A | 413 | Glycosyltransferase B736L; rossmann fold, GDP-mann | 97.28 | |
| 2r60_A | 499 | Glycosyl transferase, group 1; rossmann-fold; 1.80 | 97.26 | |
| 3qhp_A | 166 | Type 1 capsular polysaccharide biosynthesis prote | 97.23 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.02 | |
| 3q3e_A | 631 | HMW1C-like glycosyltransferase; N-glycosylation; 2 | 96.81 | |
| 2qzs_A | 485 | Glycogen synthase; glycosyl-transferase, GT-B fold | 96.28 | |
| 1rzu_A | 485 | Glycogen synthase 1; glycosyl-transferase, GT-B fo | 96.11 | |
| 3s28_A | 816 | Sucrose synthase 1; glycosyltransferase, sucrose m | 96.04 | |
| 2x0d_A | 413 | WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge | 95.44 | |
| 2hy7_A | 406 | Glucuronosyltransferase GUMK; glycosyltransferases | 94.72 | |
| 1uqt_A | 482 | Alpha, alpha-trehalose-phosphate synthase; glycosy | 92.79 | |
| 3vue_A | 536 | GBSS-I, granule-bound starch synthase 1, chloropla | 89.31 | |
| 3nb0_A | 725 | Glycogen [starch] synthase isoform 2; glycogen syn | 88.35 | |
| 2pju_A | 225 | Propionate catabolism operon regulatory protein; s | 88.28 | |
| 3l7i_A | 729 | Teichoic acid biosynthesis protein F; GT-B fold, m | 87.05 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 86.97 | |
| 2iz6_A | 176 | Molybdenum cofactor carrier protein; metal transpo | 86.86 | |
| 3t5t_A | 496 | Putative glycosyltransferase; GTB fold, pseudoglyc | 86.8 | |
| 3tl4_X | 187 | Glutaminyl-tRNA synthetase; glutamine, appended do | 85.31 | |
| 1yt5_A | 258 | Inorganic polyphosphate/ATP-NAD kinase; domain 1: | 80.45 |
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-33 Score=218.04 Aligned_cols=121 Identities=31% Similarity=0.540 Sum_probs=115.3
Q ss_pred CCCChHHhhcccCCcceecCCChhhHHHHHHcCCCeecccccccchhhHHHHHHHhcccceecCCCCCCccHHHHHHHHH
Q 035557 1 NWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGLKVPADDKGIVRREAIAHCIR 80 (129)
Q Consensus 1 ~w~pq~~iL~~~~~~~~I~hgG~~s~~eal~~gvP~i~~P~~~dq~~na~~~~~~~g~g~~~~~~~~~~~~~~~l~~~i~ 80 (129)
+|+||..+|+|+++++||||||+||++|++++|||+|++|++.||+.||+++++.||+|+.+... .+++++|.++|+
T Consensus 333 ~w~Pq~~vL~h~~v~~fvtH~G~~S~~Eal~~GvP~i~~P~~~DQ~~Na~~v~~~~g~Gv~l~~~---~~~~~~l~~av~ 409 (454)
T 3hbf_A 333 AWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMISRPFFGDQGLNTILTESVLEIGVGVDNG---VLTKESIKKALE 409 (454)
T ss_dssp SSCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHTTSCSEEECGGG---SCCHHHHHHHHH
T ss_pred eeCCHHHHHhhcCcCeEEecCCcchHHHHHHcCCCEecCcccccHHHHHHHHHHhhCeeEEecCC---CCCHHHHHHHHH
Confidence 59999999999998899999999999999999999999999999999999999966999999765 799999999999
Q ss_pred HHHhChhhHHHHHHHHHHHHHHHHHhhcCCChHHHHHHHHHHHh
Q 035557 81 EILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFVANSI 124 (129)
Q Consensus 81 ~~l~~~~~~~~~~~a~~l~~~~~~~~~~~g~~~~~~~~~~~~l~ 124 (129)
++|+++++++||+|++++++.+++++.+||||..++++|++++.
T Consensus 410 ~ll~~~~~~~~r~~a~~l~~~~~~a~~~gGsS~~~l~~~v~~i~ 453 (454)
T 3hbf_A 410 LTMSSEKGGIMRQKIVKLKESAFKAVEQNGTSAMDFTTLIQIVT 453 (454)
T ss_dssp HHHSSHHHHHHHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHT
T ss_pred HHHCCChHHHHHHHHHHHHHHHHHhhccCCCHHHHHHHHHHHHh
Confidence 99988777899999999999999999999999999999999875
|
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* | Back alignment and structure |
|---|
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* | Back alignment and structure |
|---|
| >4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* | Back alignment and structure |
|---|
| >2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* | Back alignment and structure |
|---|
| >3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* | Back alignment and structure |
|---|
| >1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 | Back alignment and structure |
|---|
| >3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* | Back alignment and structure |
|---|
| >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* | Back alignment and structure |
|---|
| >3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* | Back alignment and structure |
|---|
| >4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} | Back alignment and structure |
|---|
| >3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A | Back alignment and structure |
|---|
| >3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* | Back alignment and structure |
|---|
| >2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* | Back alignment and structure |
|---|
| >2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* | Back alignment and structure |
|---|
| >2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* | Back alignment and structure |
|---|
| >3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* | Back alignment and structure |
|---|
| >3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* | Back alignment and structure |
|---|
| >3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* | Back alignment and structure |
|---|
| >2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* | Back alignment and structure |
|---|
| >3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A | Back alignment and structure |
|---|
| >2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A | Back alignment and structure |
|---|
| >1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A | Back alignment and structure |
|---|
| >3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* | Back alignment and structure |
|---|
| >2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* | Back alignment and structure |
|---|
| >2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* | Back alignment and structure |
|---|
| >1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* | Back alignment and structure |
|---|
| >3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* | Back alignment and structure |
|---|
| >3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* | Back alignment and structure |
|---|
| >2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 | Back alignment and structure |
|---|
| >3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A | Back alignment and structure |
|---|
| >3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* | Back alignment and structure |
|---|
| >3tl4_X Glutaminyl-tRNA synthetase; glutamine, appended domain, hinge, tRNA LIG amidotransferase, ligase; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 129 | ||||
| d2vcha1 | 471 | c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera | 1e-44 | |
| d2pq6a1 | 473 | c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe | 1e-39 | |
| d2acva1 | 461 | c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf | 2e-37 | |
| d2c1xa1 | 450 | c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc | 4e-37 | |
| d1rrva_ | 401 | c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am | 4e-17 | |
| d1iira_ | 401 | c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol | 1e-16 |
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: UDPGT-like domain: Hydroquinone glucosyltransferase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 149 bits (375), Expect = 1e-44
Identities = 45/128 (35%), Positives = 71/128 (55%)
Query: 1 NWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGL 60
W PQ +VLAH +TG FLTHCGWNST+E+ G+P++A P + +Q N+ + + + L
Sbjct: 340 FWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAAL 399
Query: 61 KVPADDKGIVRREAIAHCIREILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFV 120
+ A D G+VRRE +A ++ ++EGE K +R + A + G+S K +
Sbjct: 400 RPRAGDDGLVRREEVARVVKGLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVA 459
Query: 121 ANSISSKS 128
+ K
Sbjct: 460 LKWKAHKK 467
|
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 | Back information, alignment and structure |
|---|
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| d2vcha1 | 471 | Hydroquinone glucosyltransferase {Thale cress (Ara | 100.0 | |
| d2pq6a1 | 473 | (Iso)flavonoid glycosyltransferase {Medicago trunc | 100.0 | |
| d2acva1 | 461 | Triterpene UDP-glucosyl transferase UGT71G1 {Medic | 100.0 | |
| d2c1xa1 | 450 | UDP glucose:flavonoid 3-o-glucosyltransferase {Gra | 99.98 | |
| d1iira_ | 401 | UDP-glucosyltransferase GtfB {Amycolatopsis orient | 99.94 | |
| d1rrva_ | 401 | TDP-vancosaminyltransferase GftD {Amycolatopsis or | 99.93 | |
| d1pn3a_ | 391 | TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi | 99.92 | |
| d1f0ka_ | 351 | Peptidoglycan biosynthesis glycosyltransferase Mur | 99.68 | |
| d2iw1a1 | 370 | Lipopolysaccharide core biosynthesis protein RfaG | 98.12 | |
| d2f9fa1 | 166 | First mannosyl transferase WbaZ {Archaeoglobus ful | 97.36 | |
| d2bfwa1 | 196 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 97.2 | |
| d2bisa1 | 437 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 96.94 | |
| d1v4va_ | 373 | UDP-N-acetylglucosamine 2-epimerase {Thermus therm | 96.53 | |
| d1o6ca_ | 377 | UDP-N-acetylglucosamine 2-epimerase {Bacillus subt | 96.27 | |
| d1rzua_ | 477 | Glycogen synthase 1, GlgA {Agrobacterium tumefacie | 95.74 | |
| d1f6da_ | 376 | UDP-N-acetylglucosamine 2-epimerase {Escherichia c | 94.38 | |
| d1uqta_ | 456 | Trehalose-6-phosphate synthase, OtsA {Escherichia | 93.39 | |
| d2pjua1 | 186 | Propionate catabolism operon regulatory protein Pr | 83.75 |
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: UDPGT-like domain: Hydroquinone glucosyltransferase species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=4.6e-37 Score=231.17 Aligned_cols=126 Identities=35% Similarity=0.632 Sum_probs=117.9
Q ss_pred CCCChHHhhcccCCcceecCCChhhHHHHHHcCCCeecccccccchhhHHHHHHHhcccceecCCCCCCccHHHHHHHHH
Q 035557 1 NWCPQLEVLAHEATGCFLTHCGWNSTMEARSLGVPMVAMPQWTDQSTNSKCVMDVWKTGLKVPADDKGIVRREAIAHCIR 80 (129)
Q Consensus 1 ~w~pq~~iL~~~~~~~~I~hgG~~s~~eal~~gvP~i~~P~~~dq~~na~~~~~~~g~g~~~~~~~~~~~~~~~l~~~i~ 80 (129)
+|+||.+||.|+++++||||||+||++||+++|||||++|+++||+.||+++++.+|+|+.+...+.+.+++++|.++|+
T Consensus 340 ~w~Pq~~lL~hp~~~~fVtHGG~gS~~EAl~~GvP~v~~P~~~DQ~~nA~rv~e~lG~Gv~l~~~~~~~~t~~~l~~ai~ 419 (471)
T d2vcha1 340 FWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVK 419 (471)
T ss_dssp SCCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTCCEECCCCCTTSCCCHHHHHHHHH
T ss_pred ccCCHHHHhcCccCCEEEecCCccHHHHHHHcCCCEEEcccccccHHHHHHHHHHheeEEEEecCCCCcCCHHHHHHHHH
Confidence 59999999999999999999999999999999999999999999999999997755999999776445689999999999
Q ss_pred HHHhChhhHHHHHHHHHHHHHHHHHhhcCCChHHHHHHHHHHHhhC
Q 035557 81 EILEGERCKEIRQNAGKWSNFAKEAVTKGGSSDKNIDDFVANSISS 126 (129)
Q Consensus 81 ~~l~~~~~~~~~~~a~~l~~~~~~~~~~~g~~~~~~~~~~~~l~~~ 126 (129)
++|+|++|++||+||++|++++++++++||+|.++++.|++.++..
T Consensus 420 ~vl~~~~~~~~r~ra~~l~e~~~~a~~~gG~s~~~~~~~~~~~~~~ 465 (471)
T d2vcha1 420 GLMEGEEGKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKAH 465 (471)
T ss_dssp HHHTSTHHHHHHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHHH
T ss_pred HHhCCcHHHHHHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHh
Confidence 9999987778999999999999999999999999999999998864
|
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|