Citrus Sinensis ID: 035581


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------
MYSGSSDGESHEAAQRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQEDEEPEEE
ccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHcccccHHHHHHHHHcccEEEEEccccccccEEEEcccccHHHHHHHHHHHcccHHHccHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccEEHHHHHHcccccccccccccHHHHHHHHccccccccccccccc
***********************MLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFR***************************RVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRG***GGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNR*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSGSSDGESHEAAQRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCxxxxxxxxxxxxxxxxxxxxxENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQEDEEPEEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 Probable regulatory subunit of type 2A protein phosphatase involved in the control of the dynamic organization of the cortical cytoskeleton. Plays an important role in the organization of interphase microtubule arrays in part through the regulation of nucleation geometry. Required for the reorganization of cortical arrays in response to light.confidentQ9FEE2
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma Possible role in the regulation of cell death.probableQ6DJ05
Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma May regulate MCM3AP phosphorylation through phosphatase recruitment. May play a role in the activation-induced cell death of B-cells.probableQ969Q6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BE4, chain A
Confidence level:confident
Coverage over the Query: 105-363
View the alignment between query and template
View the model in PyMOL
Template: 2BE4, chain A
Confidence level:confident
Coverage over the Query: 188-274,285-441
View the alignment between query and template
View the model in PyMOL
Template: 2GGZ, chain A
Confidence level:confident
Coverage over the Query: 301-464
View the alignment between query and template
View the model in PyMOL
Template: 1EG3, chain A
Confidence level:confident
Coverage over the Query: 86-263
View the alignment between query and template
View the model in PyMOL