Citrus Sinensis ID: 035581

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470------

MYSGSSDGESHEAAQRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQEDEEPEEE

ccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHHHHHccccccccccHHHHHHHHHHHcccHHHHcccccHHHHHHHHHcccEEEEEccccccccEEEEcccccHHHHHHHHHHHccHHHHccHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccEEHHHHHHcccccccccccccHHHHHHHHccccccccccccccc

ccccccccccHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccEcccccccHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHHHHccccccHccHHHHHHcccccccEEEHHHHHHHHHHHHHccHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHcccHHHHHHHHHHHHHHHHEEEcccccccEEHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHccHHHEEEEEEHHHHccccccccEcHHHHHHcccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccHHHEHEEEEcccccccEcHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccEEHHHHHHcccccHEHHEEHcHHHHHHHHccccHHHcccccccc

mysgssdgesheaaqrkippassmlWVRNLRRFIgsgtglgseALMELETKRILLDIFREKQqksaeagtipsfykkkpeegsiSHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRencviddatgaekmnyedfchiasvcteqigpkcrrffspsnfmkfekdesgriaiLPFYLYVMRTVSLTQaridmseldedsdgflqphEMEAYIRGLIPslaqlrdmptGFIQMYCRIAAHkffffcdphrrgkacIKKVLLSNCLQELMELHqeseeevtdteQAENWFSLTSAQRVCDMFIALdkdangtlskQELREYADGTLTEIFIERVFDEHVRrgksgggnaremdFDNFLDFVLALENKDTPEGLTYLFRSLdlqergylttaDIHSLFRDVHQKwieggnyelCIEDVRDEIwdmvkpadplrITLADLlsckqggtvASMLIDVRgfwahdnrenllqedeepeee

mysgssdgesheaaqrkippassmlwVRNLRRFIGSgtglgsealMELETKRILLDIFREkqqksaeagtipsfykkkpeegsisHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKdangtlskQELREYADGTLTEIFIERVFDEHVRRGKsgggnaremdFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRenllqedeepeee

MYSGSSDGESHEAAQRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSdlllnaddldaMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNClqelmelhqeseeeVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQedeepeee

***********************MLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFR***************************RVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQ*********************EAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMEL**************ENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRG******AREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHD***************

**********************************************************************************************RFL**********DDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRG***GGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNR*************

****************KIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMEL*************AENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENL**********

**********************SMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKS*****REMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNREN***********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MYSGSSDGESHEAAQRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCxxxxxxxxxxxxxxxxxxxxxENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQEDEEPEEE

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		476	2.2.26 [Sep-21-2011]
Q9FEE2		480	Probable serine/threonine	yes	no	0.983	0.975	0.904	0.0
Q9JK24		453	Serine/threonine-protein	yes	no	0.911	0.958	0.384	4e-81
Q6AXZ3		453	Serine/threonine-protein	yes	no	0.911	0.958	0.382	5e-81
Q5E9G1		453	Serine/threonine-protein	yes	no	0.911	0.958	0.380	9e-81
Q969Q6		453	Serine/threonine-protein	yes	no	0.911	0.958	0.378	8e-80
Q6DJ05		448	Serine/threonine-protein	yes	no	0.911	0.968	0.389	3e-78
Q803V3		457	Serine/threonine-protein	yes	no	0.813	0.846	0.4	4e-77
Q06190		1150	Serine/threonine-protein	no	no	0.518	0.214	0.274	2e-17
Q9Z176		491	Serine/threonine-protein	no	no	0.504	0.488	0.259	3e-15
Q9Y5P8		575	Serine/threonine-protein	no	no	0.506	0.419	0.229	6e-13

>sp\|Q9FEE2\|TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana GN=TON2 PE=1 SV=1	Back alignment and function desciption

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/469 (90%), Positives = 446/469 (95%), Gaps = 1/469 (0%)

Query: 1   MYSGSSDGESHEAA-QRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFR 59
           MYSGSSDGESH+ + QRKIPPASSMLWVRNLRR+IGSG GLGSEALMELETKRILL+IF+
Sbjct: 1   MYSGSSDGESHDTSTQRKIPPASSMLWVRNLRRYIGSGAGLGSEALMELETKRILLEIFK 60

Query: 60  EKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRE 119
           EKQQKS EAGTIPSFYKKKPEEGSIS RVQ+LAKYRFLKKQSDLLLNADDL AMWVCLRE
Sbjct: 61  EKQQKSQEAGTIPSFYKKKPEEGSISQRVQKLAKYRFLKKQSDLLLNADDLAAMWVCLRE 120

Query: 120 NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYL 179
           NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDE+GRIAILPFYL
Sbjct: 121 NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDEAGRIAILPFYL 180

Query: 180 YVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIA 239
           YVMRTVSLTQARIDMSELDEDSDGFL   EME+YI GLIP+LAQLRDMP  F QMYCRIA
Sbjct: 181 YVMRTVSLTQARIDMSELDEDSDGFLHSDEMESYIGGLIPNLAQLRDMPPAFNQMYCRIA 240

Query: 240 AHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVC 299
           + KFFFFCDPHRRG+ACIKK+LLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQR+C
Sbjct: 241 SQKFFFFCDPHRRGRACIKKILLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRIC 300

Query: 300 DMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLD 359
           DMF+ALDKD +G+L KQEL+EYADGTLTEIFIERVFDEHVRRGK   GN+REMDFD+FLD
Sbjct: 301 DMFLALDKDMSGSLCKQELKEYADGTLTEIFIERVFDEHVRRGKIVAGNSREMDFDSFLD 360

Query: 360 FVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRD 419
           FVLALENKDTPEGLTYLFR LDLQ RG+LTTADIHSLFRDVHQKWIEGGNYELCIEDVRD
Sbjct: 361 FVLALENKDTPEGLTYLFRCLDLQGRGFLTTADIHSLFRDVHQKWIEGGNYELCIEDVRD 420

Query: 420 EIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQ 468
           EIWDMVKP+DPL+ITL DLL CKQGGTVASMLIDVRGFWAHDNRENLLQ
Sbjct: 421 EIWDMVKPSDPLKITLGDLLGCKQGGTVASMLIDVRGFWAHDNRENLLQ 469

Probable regulatory subunit of type 2A protein phosphatase involved in the control of the dynamic organization of the cortical cytoskeleton. Plays an important role in the organization of interphase microtubule arrays in part through the regulation of nucleation geometry. Required for the reorganization of cortical arrays in response to light.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9JK24\|P2R3C_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Mus musculus GN=Ppp2r3c PE=1 SV=2	Back alignment and function description

>sp\|Q6AXZ3\|P2R3C_RAT Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Rattus norvegicus GN=Ppp2r3c PE=2 SV=1	Back alignment and function description

>sp\|Q5E9G1\|P2R3C_BOVIN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Bos taurus GN=PPP2R3C PE=2 SV=1	Back alignment and function description

>sp\|Q969Q6\|P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens GN=PPP2R3C PE=1 SV=1	Back alignment and function description

>sp\|Q6DJ05\|P2R3C_XENTR Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Xenopus tropicalis GN=ppp2r3c PE=2 SV=1	Back alignment and function description

>sp\|Q803V3\|P2R3C_DANRE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Danio rerio GN=ppp2r3c PE=2 SV=1	Back alignment and function description

>sp\|Q06190\|P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens GN=PPP2R3A PE=1 SV=1	Back alignment and function description

>sp\|Q9Z176\|P2R3A_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Mus musculus GN=Ppp2r3a PE=2 SV=1	Back alignment and function description

>sp\|Q9Y5P8\|P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens GN=PPP2R3B PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		476
255551683		477	tonneau, putative [Ricinus communis] gi\|	0.983	0.981	0.950	0.0
225432352		476	PREDICTED: serine/threonine-protein phos	0.983	0.983	0.950	0.0
297807879		480	hypothetical protein ARALYDRAFT_909871 [	0.983	0.975	0.918	0.0
224123150		485	predicted protein [Populus trichocarpa]	0.983	0.964	0.935	0.0
356563880		477	PREDICTED: serine/threonine-protein phos	0.983	0.981	0.927	0.0
356521893		477	PREDICTED: serine/threonine-protein phos	0.983	0.981	0.927	0.0
18418838		480	protein tonneau 2 [Arabidopsis thaliana]	0.983	0.975	0.904	0.0
449432821		475	PREDICTED: serine/threonine-protein phos	0.981	0.983	0.918	0.0
226507630		484	phosphatase subunit g4-1 [Zea mays] gi\|1	0.972	0.956	0.878	0.0
242086911		490	hypothetical protein SORBIDRAFT_09g00383	0.941	0.914	0.917	0.0

>gi\|255551683\|ref\|XP_002516887.1\| tonneau, putative [Ricinus communis] gi\|223543975\|gb\|EEF45501.1\| tonneau, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/469 (95%), Positives = 458/469 (97%), Gaps = 1/469 (0%)

Query: 1   MYSGSSDGESHE-AAQRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFR 59
           MYSGSSDGESHE AA RKIPPASSMLWVRNLRR+IGSG GLGSEALMELETKRILLDIF+
Sbjct: 1   MYSGSSDGESHETAAHRKIPPASSMLWVRNLRRYIGSGAGLGSEALMELETKRILLDIFK 60

Query: 60  EKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRE 119
           EKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRE
Sbjct: 61  EKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSDLLLNADDLDAMWVCLRE 120

Query: 120 NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYL 179
           NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYL
Sbjct: 121 NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYL 180

Query: 180 YVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIA 239
           YVMRTVSLTQARIDMSELDEDSDGFLQP EME+YIRGLIP+LAQLRDMP  F+QMYCRIA
Sbjct: 181 YVMRTVSLTQARIDMSELDEDSDGFLQPQEMESYIRGLIPNLAQLRDMPAQFVQMYCRIA 240

Query: 240 AHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVC 299
           AHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQR+C
Sbjct: 241 AHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRIC 300

Query: 300 DMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLD 359
           DMF+ALDKD NGTLSKQELREYADGTLTEIFIERVFDEHVRRGK+GGGN+REMDFD+FLD
Sbjct: 301 DMFLALDKDMNGTLSKQELREYADGTLTEIFIERVFDEHVRRGKTGGGNSREMDFDSFLD 360

Query: 360 FVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRD 419
           FVLALENKDTPEGLTYLFR LDLQ RGYLTTADIHSLFRDVH KWIEGGNYELCIEDVRD
Sbjct: 361 FVLALENKDTPEGLTYLFRCLDLQGRGYLTTADIHSLFRDVHHKWIEGGNYELCIEDVRD 420

Query: 420 EIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQ 468
           EIWDMVKP DPL+ITL+DLLSCKQGGTVASMLIDVRGFWAHDNRENLLQ
Sbjct: 421 EIWDMVKPTDPLKITLSDLLSCKQGGTVASMLIDVRGFWAHDNRENLLQ 469

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225432352\|ref\|XP_002275193.1\| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma [Vitis vinifera] gi\|297736895\|emb\|CBI26096.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297807879\|ref\|XP_002871823.1\| hypothetical protein ARALYDRAFT_909871 [Arabidopsis lyrata subsp. lyrata] gi\|297317660\|gb\|EFH48082.1\| hypothetical protein ARALYDRAFT_909871 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|224123150\|ref\|XP_002330351.1\| predicted protein [Populus trichocarpa] gi\|222871555\|gb\|EEF08686.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356563880\|ref\|XP_003550185.1\| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma-like [Glycine max]	Back alignment and taxonomy information

>gi\|356521893\|ref\|XP_003529585.1\| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma-like [Glycine max]	Back alignment and taxonomy information

>gi|18418838|ref|NP_568364.1| protein tonneau 2 [Arabidopsis thaliana] gi|75333699|sp|Q9FEE2.1|TON2_ARATH RecName: Full=Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2; AltName: Full=Protein EMBRYO DEFFECTIVE 40; AltName: Full=Protein GORDO; AltName: Full=Protein TONNEAU 2 gi|11494362|gb|AAG35778.1|AF280057_1 tonneau 2 [Arabidopsis thaliana] gi|11494385|gb|AAG35792.1|AF290025_1 tonneau 2 [Arabidopsis thaliana] gi|13430808|gb|AAK26026.1|AF360316_1 unknown protein [Arabidopsis thaliana] gi|21281193|gb|AAM44936.1| unknown protein [Arabidopsis thaliana] gi|332005198|gb|AED92581.1| protein tonneau 2 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|449432821\|ref\|XP_004134197.1\| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma-like [Cucumis sativus] gi\|449526987\|ref\|XP_004170494.1\| PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|226507630\|ref\|NP_001148688.1\| phosphatase subunit g4-1 [Zea mays] gi\|195621430\|gb\|ACG32545.1\| phosphatase subunit g4-1 [Zea mays] gi\|195625702\|gb\|ACG34681.1\| phosphatase subunit g4-1 [Zea mays]	Back alignment and taxonomy information

>gi\|242086911\|ref\|XP_002439288.1\| hypothetical protein SORBIDRAFT_09g003830 [Sorghum bicolor] gi\|241944573\|gb\|EES17718.1\| hypothetical protein SORBIDRAFT_09g003830 [Sorghum bicolor]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		476
TAIR\|locus:2183003		480	FASS "FASS 1" [Arabidopsis tha	0.983	0.975	0.852	3.1e-218
UNIPROTKB\|F1N899		456	PPP2R3C "Uncharacterized prote	0.903	0.942	0.375	1.1e-69
RGD\|1309207		453	Ppp2r3c "protein phosphatase 2	0.901	0.947	0.367	3.5e-68
MGI\|MGI:1930009		453	Ppp2r3c "protein phosphatase 2	0.901	0.947	0.369	4.4e-68
UNIPROTKB\|E2RNM2		453	PPP2R3C "Uncharacterized prote	0.901	0.947	0.362	7.2e-68
UNIPROTKB\|Q5E9G1		453	PPP2R3C "Serine/threonine-prot	0.901	0.947	0.364	9.2e-68
UNIPROTKB\|Q969Q6		453	PPP2R3C "Serine/threonine-prot	0.901	0.947	0.362	4e-67
ZFIN\|ZDB-GENE-040426-715		457	ppp2r3c "protein phosphatase 2	0.802	0.835	0.382	2.5e-65
UNIPROTKB\|H0YJC5		226	PPP2R3C "Serine/threonine-prot	0.384	0.809	0.401	3.9e-28
TAIR\|locus:2150446		536	AT5G28850 [Arabidopsis thalian	0.647	0.574	0.226	6e-16

TAIR\|locus:2183003 FASS "FASS 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2108 (747.1 bits), Expect = 3.1e-218, P = 3.1e-218
 Identities = 400/469 (85%), Positives = 422/469 (89%)

Query:     1 MYSGSSDGESHEAA-QRKIPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFR 59
             MYSGSSDGESH+ + QRKIPPASSMLWVRNLRR+IGSG GLGSEALMELETKRILL+IF+
Sbjct:     1 MYSGSSDGESHDTSTQRKIPPASSMLWVRNLRRYIGSGAGLGSEALMELETKRILLEIFK 60

Query:    60 EKQQKSAEAGTIPSFYKKKPEEGSISHRVQRLAKYRFLKKQSXXXXXXXXXXXMWVCLRE 119
             EKQQKS EAGTIPSFYKKKPEEGSIS RVQ+LAKYRFLKKQS           MWVCLRE
Sbjct:    61 EKQQKSQEAGTIPSFYKKKPEEGSISQRVQKLAKYRFLKKQSDLLLNADDLAAMWVCLRE 120

Query:   120 NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAILPFYL 179
             NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDE+GRIAILPFYL
Sbjct:   121 NCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDEAGRIAILPFYL 180

Query:   180 YVMRTVSLTQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRDMPTGFIQMYCRIA 239
             YVMRTVSLTQARIDMSELDEDSDGFL   EME+YI GLIP+LAQLRDMP  F QMYCRIA
Sbjct:   181 YVMRTVSLTQARIDMSELDEDSDGFLHSDEMESYIGGLIPNLAQLRDMPPAFNQMYCRIA 240

Query:   240 AHKFFFFCDPHRRGKACIKKVLLSNCXXXXXXXXXXXXXXVTDTEQAENWFSLTSAQRVC 299
             + KFFFFCDPHRRG+ACIKK+LLSNC              VTDTEQAENWFSLTSAQR+C
Sbjct:   241 SQKFFFFCDPHRRGRACIKKILLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRIC 300

Query:   300 DMFIALDKDANGTLSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDNFLD 359
             DMF+ALDKD +G+L KQEL+EYADGTLTEIFIERVFDEHVRRGK   GN+REMDFD+FLD
Sbjct:   301 DMFLALDKDMSGSLCKQELKEYADGTLTEIFIERVFDEHVRRGKIVAGNSREMDFDSFLD 360

Query:   360 FVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRD 419
             FVLALENKDTPEGLTYLFR LDLQ RG+LTTADIHSLFRDVHQKWIEGGNYELCIEDVRD
Sbjct:   361 FVLALENKDTPEGLTYLFRCLDLQGRGFLTTADIHSLFRDVHQKWIEGGNYELCIEDVRD 420

Query:   420 EIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENLLQ 468
             EIWDMVKP+DPL+ITL DLL CKQGGTVASMLIDVRGFWAHDNRENLLQ
Sbjct:   421 EIWDMVKPSDPLKITLGDLLGCKQGGTVASMLIDVRGFWAHDNRENLLQ 469

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0000226 "microtubule cytoskeleton organization" evidence=IMP

GO:0000913 "preprophase band assembly" evidence=IMP

GO:0005515 "protein binding" evidence=IPI

GO:0030359 "protein phosphatase type 2B regulator activity" evidence=ISS

GO:0030865 "cortical cytoskeleton organization" evidence=IMP

GO:0005737 "cytoplasm" evidence=IDA

GO:0005819 "spindle" evidence=IDA

GO:0009524 "phragmoplast" evidence=IDA

GO:0007155 "cell adhesion" evidence=RCA

GO:0010090 "trichome morphogenesis" evidence=RCA

GO:0045010 "actin nucleation" evidence=RCA

GO:0048765 "root hair cell differentiation" evidence=RCA

GO:0071555 "cell wall organization" evidence=RCA

GO:0009826 "unidimensional cell growth" evidence=TAS

UNIPROTKB\|F1N899 PPP2R3C "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1309207 Ppp2r3c "protein phosphatase 2, regulatory subunit B'', gamma" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1930009 Ppp2r3c "protein phosphatase 2, regulatory subunit B'', gamma" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RNM2 PPP2R3C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5E9G1 PPP2R3C "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q969Q6 PPP2R3C "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-715 ppp2r3c "protein phosphatase 2, regulatory subunit B'', gamma" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|H0YJC5 PPP2R3C "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

TAIR\|locus:2150446 AT5G28850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6DJ05	P2R3C_XENTR	No assigned EC number	0.3890	0.9117	0.9687	yes	no
Q969Q6	P2R3C_HUMAN	No assigned EC number	0.3782	0.9117	0.9580	yes	no
Q803V3	P2R3C_DANRE	No assigned EC number	0.4	0.8130	0.8468	yes	no
Q5E9G1	P2R3C_BOVIN	No assigned EC number	0.3804	0.9117	0.9580	yes	no
Q6AXZ3	P2R3C_RAT	No assigned EC number	0.3826	0.9117	0.9580	yes	no
Q9FEE2	TON2_ARATH	No assigned EC number	0.9040	0.9831	0.975	yes	no
Q9JK24	P2R3C_MOUSE	No assigned EC number	0.3847	0.9117	0.9580	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		476
KOG2562		493	consensus Protein phosphatase 2 regulatory subunit	100.0
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	99.9
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.83
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	99.75
KOG0044		193	consensus Ca2+ sensor (EF-Hand superfamily) [Signa	99.73
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	99.7
PTZ00183		158	centrin; Provisional	99.58
PTZ00184		149	calmodulin; Provisional	99.57
COG5126		160	FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S	99.54
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	99.51
KOG0027		151	consensus Calmodulin and related proteins (EF-Hand	99.51
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	99.46
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	99.44
KOG0034		187	consensus Ca2+/calmodulin-dependent protein phosph	99.36
PTZ00184		149	calmodulin; Provisional	99.24
KOG0038		189	consensus Ca2+-binding kinase interacting protein	99.23
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	99.21
KOG0036		463	consensus Predicted mitochondrial carrier protein	99.2
PTZ00183		158	centrin; Provisional	99.17
KOG0028		172	consensus Ca2+-binding protein (centrin/caltractin	99.14
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	99.09
KOG0037		221	consensus Ca2+-binding protein, EF-Hand protein su	99.04
KOG0036		463	consensus Predicted mitochondrial carrier protein	99.04
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	99.02
KOG4223		325	consensus Reticulocalbin, calumenin, DNA supercoil	98.99
PLN02964		644	phosphatidylserine decarboxylase	98.95
KOG0030		152	consensus Myosin essential light chain, EF-Hand pr	98.71
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	98.67
KOG0031		171	consensus Myosin regulatory light chain, EF-Hand p	98.63
KOG0038		189	consensus Ca2+-binding kinase interacting protein	98.6
PF13499		66	EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A	98.55
KOG2643		489	consensus Ca2+ binding protein, contains EF-hand m	98.49
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	98.48
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	98.39
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.38
KOG4251		362	consensus Calcium binding protein [General functio	98.38
cd05022		89	S-100A13 S-100A13: S-100A13 domain found in protei	98.37
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	98.3
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	98.28
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	98.26
cd00252		116	SPARC_EC SPARC_EC; extracellular Ca2+ binding doma	98.23
cd05027		88	S-100B S-100B: S-100B domain found in proteins sim	98.2
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.17
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.17
KOG4251		362	consensus Calcium binding protein [General functio	98.16
cd00052		67	EH Eps15 homology domain; found in proteins implic	98.15
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	98.14
cd05026		93	S-100Z S-100Z: S-100Z domain found in proteins sim	98.11
cd05025		92	S-100A1 S-100A1: S-100A1 domain found in proteins	98.09
cd00213		88	S-100 S-100: S-100 domain, which represents the la	98.09
cd05031		94	S-100A10_like S-100A10_like: S-100A10 domain found	98.07
KOG2562		493	consensus Protein phosphatase 2 regulatory subunit	97.94
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	97.92
cd00052		67	EH Eps15 homology domain; found in proteins implic	97.92
smart00027		96	EH Eps15 homology domain. Pair of EF hand motifs t	97.9
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	97.86
KOG0377		631	consensus Protein serine/threonine phosphatase RDG	97.83
cd05023		89	S-100A11 S-100A11: S-100A11 domain found in protei	97.79
cd00213		88	S-100 S-100: S-100 domain, which represents the la	97.78
cd05029		88	S-100A6 S-100A6: S-100A6 domain found in proteins	97.76
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	97.75
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	97.74
KOG0751		694	consensus Mitochondrial aspartate/glutamate carrie	97.71
PF13833		54	EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A	97.69
PLN02964		644	phosphatidylserine decarboxylase	97.64
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	97.64
KOG4666		412	consensus Predicted phosphate acyltransferase, con	97.61
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	97.58
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	97.56
cd00051		63	EFh EF-hand, calcium binding motif; A diverse supe	97.49
KOG0751		694	consensus Mitochondrial aspartate/glutamate carrie	97.39
PF14658		66	EF-hand_9: EF-hand domain	97.26
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	97.2
KOG0040		2399	consensus Ca2+-binding actin-bundling protein (spe	97.19
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	97.14
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	97.08
KOG0041		244	consensus Predicted Ca2+-binding protein, EF-Hand	96.97
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	96.91
PF00036		29	EF-hand_1: EF hand; InterPro: IPR018248 Many calci	96.87
PF14658		66	EF-hand_9: EF-hand domain	96.83
PF13202		25	EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ	96.73
PF10591		113	SPARC_Ca_bdg: Secreted protein acidic and rich in	96.73
cd05030		88	calgranulins Calgranulins: S-100 domain found in p	96.59
KOG4065		144	consensus Uncharacterized conserved protein [Funct	96.56
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	96.53
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	96.49
PF13405		31	EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J	96.33
PRK12309		391	transaldolase/EF-hand domain-containing protein; P	96.23
cd05024		91	S-100A10 S-100A10: A subgroup of the S-100A10 doma	95.64
KOG0046		627	consensus Ca2+-binding actin-bundling protein (fim	95.61
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	95.57
PF12763		104	EF-hand_4: Cytoskeletal-regulatory complex EF hand	95.4
KOG4347		671	consensus GTPase-activating protein VRP [General f	95.34
KOG4065		144	consensus Uncharacterized conserved protein [Funct	95.14
KOG0169		746	consensus Phosphoinositide-specific phospholipase	94.57
KOG4666		412	consensus Predicted phosphate acyltransferase, con	94.48
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	93.98
KOG3866		442	consensus DNA-binding protein of the nucleobindin	93.17
PF14788		51	EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA	92.58
KOG0046		627	consensus Ca2+-binding actin-bundling protein (fim	92.38
PF09279		83	EF-hand_like: Phosphoinositide-specific phospholip	92.12
smart00054		29	EFh EF-hand, calcium binding motif. EF-hands are c	90.97
KOG4578		421	consensus Uncharacterized conserved protein, conta	90.35
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	89.93
KOG0169		746	consensus Phosphoinositide-specific phospholipase	89.52
PF09069		90	EF-hand_3: EF-hand; InterPro: IPR015154 Like other	89.36
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	89.13
KOG3555		434	consensus Ca2+-binding proteoglycan Testican [Gene	88.72
KOG1707		625	consensus Predicted Ras related/Rac-GTP binding pr	86.92
KOG3866		442	consensus DNA-binding protein of the nucleobindin	86.78
KOG4347		671	consensus GTPase-activating protein VRP [General f	86.42
KOG4578		421	consensus Uncharacterized conserved protein, conta	85.82
PF14513		138	DAG_kinase_N: Diacylglycerol kinase N-terminus; PD	85.4
PF08726		69	EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr	84.1
KOG3555		434	consensus Ca2+-binding proteoglycan Testican [Gene	81.35
KOG4004		259	consensus Matricellular protein Osteonectin/SPARC/	81.17

>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=1.2e-79  Score=621.31  Aligned_cols=428  Identities=33%  Similarity=0.500  Sum_probs=385.2

Q ss_pred             CCCCCCchHHHHHHHHhcCCCCCChhHhhhHHHHHHHHHHHHHHhhcCCCCCCCCCccccCCCcch-hHHHHHHHHHHHH
Q 035581           18 IPPASSMLWVRNLRRFIGSGTGLGSEALMELETKRILLDIFREKQQKSAEAGTIPSFYKKKPEEGS-ISHRVQRLAKYRF   96 (476)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~f~~~~~~~~~-l~~~~~~~a~~~~   96 (476)
                      .++...|.|+.+ +++++++......-..                ...+.+++||+||+++|..++ +..+.|..+++.+
T Consensus        19 ~~~~~~~~l~~~-~~~~~sl~~~~~~~~~----------------~n~~~~~si~~~~~~~P~~~~~~~~~~~~s~~~~~   81 (493)
T KOG2562|consen   19 SKPASSQELFDQ-RRLVGSLAGDAKAGLP----------------ENVSELPSIFPFYTKPPLSPRSILGSPRTSRQRTF   81 (493)
T ss_pred             CchhHHHHHHHH-HHHHHHhhhhhhhccc----------------cccccccccccCCCCCCCCCCCCCCCcchhhhccC
Confidence            444556667776 6666664321111111                123368999999999955554 9999999999999


Q ss_pred             HHhhhcccCCHHHHHHHHHHHHhcCCCCCCCCCCccChhh-HHHHHHHhhhhcCccccccCcHHHhhccccCCCCCcchH
Q 035581           97 LKKQSDLLLNADDLDAMWVCLRENCVIDDATGAEKMNYED-FCHIASVCTEQIGPKCRRFFSPSNFMKFEKDESGRIAIL  175 (476)
Q Consensus        97 L~~~~~~l~~~~El~~l~~~~~~~~~~~~~~~~~~i~~~~-F~~i~~~~~~~~~~~~~~~f~~~lF~~f~~d~~G~Is~~  175 (476)
                      |+.++.+++.++.+..+|..|.++|+++....+++++|.+ |..+...+.  -.++|+.||++++|.++.++..|+|++.
T Consensus        82 ~~~s~~~~~~~~~~~i~~f~f~~~~~~~~~~~e~~l~~~n~~~~~~~vs~--~vck~~~f~s~~~f~k~~~d~~g~it~~  159 (493)
T KOG2562|consen   82 LNLSSLELLNNDSLLIPDFYFPNGRPPPLETKEQKLNRENRFAEIGSVSK--EVCKCPSFFSASTFRKIDGDDTGHITRD  159 (493)
T ss_pred             CCcChHHHhcCchhcccceeccCCCCChhhhhHHHHHHHHhhhhhhhhhc--ccccCccccchhhhhhhccCcCCceeHH
Confidence            9999999999999999999999999999999999999998 888888764  2578999999999999999999999999


Q ss_pred             HHHHHHHHhhhhhhhhhh--hccccCCCCCCCCHHHHHHHHHHHchhcccCCC--CChhhHHHHHHHHHHHHhhhcCCCC
Q 035581          176 PFYLYVMRTVSLTQARID--MSELDEDSDGFLQPHEMEAYIRGLIPSLAQLRD--MPTGFIQMYCRIAAHKFFFFCDPHR  251 (476)
Q Consensus       176 ~F~~~~~~~~~~~q~r~~--f~~yD~d~~G~I~~~Dl~~~i~~li~~~p~l~~--l~p~F~~~Y~~~vv~rif~~lD~~~  251 (476)
                      .|++||++.+++.++++.  +++++..+.|||.+.||+++++++|++|| |++  .+|+|+++|+++|+.||||.+|+.|
T Consensus       160 ~Fi~~~~~~~~l~~t~~~~~v~~l~~~~~~yl~q~df~~~Lqeli~Thp-l~~l~~~pEf~~~Y~~tvi~rIFy~~nrs~  238 (493)
T KOG2562|consen  160 KFINYWMRGLMLTHTRLEQFVNLLIQAGCSYLRQDDFKPYLQELIATHP-LEFLDEEPEFQERYAETVIQRIFYYLNRSR  238 (493)
T ss_pred             HHHHHHHhhhhHHHHHHHHHHHHHhccCccceeccccHHHHHHHHhcCC-chhhccChhHHHHHHHHHhhhhheeeCCcc
Confidence            999999999999999998  99999999999999999999999999999 666  5799999999999999999999999


Q ss_pred             CCcccHHHHHhhhhHHHHHHhchhchhhhhhhhhhcCCCCHHHHHHHHHHHhhhCCCCCCcccHHHHHHhhCCCCCHHHH
Q 035581          252 RGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYADGTLTEIFI  331 (476)
Q Consensus       252 dGrIti~Ef~~s~~l~~l~~l~~~~ee~~~~~~~~~~~FS~~~~~~l~~~F~~lD~D~dG~Is~~EL~~~~~~~~t~~~i  331 (476)
                      +|+|+++|+++|++++++.++.+   |  .++++..+|||++|++++||+||+||+||||.|++++|++|..+++|..+|
T Consensus       239 tG~iti~el~~snll~~l~~l~e---E--ed~nq~~~~FS~e~f~viy~kFweLD~Dhd~lidk~~L~ry~d~tlt~~iv  313 (493)
T KOG2562|consen  239 TGRITIQELLRSNLLDALLELDE---E--EDINQVTRYFSYEHFYVIYCKFWELDTDHDGLIDKEDLKRYGDHTLTERIV  313 (493)
T ss_pred             CCceeHHHHHHhHHHHHHHHHHH---H--hhhhhhhhheeHHHHHHHHHHHhhhccccccccCHHHHHHHhccchhhHHH
Confidence            99999999999999999999975   3  388999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCCCCCCCcccHHHHHHHHHHccCCCCHHHHHHHhHhhcCCCCCcccHHHHHHHHHHHHHHHhhcCCCC
Q 035581          332 ERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYE  411 (476)
Q Consensus       332 ~rif~~~d~~~~~~~~~dG~Idf~eFl~fll~~e~~~~~~~l~~~F~ilD~DgdG~Is~~EL~~f~~~i~~~l~~~g~~~  411 (476)
                      +|||+.+ +.+ ....++|.|||++|++|++|++++.++++++|||+++|+||+|+|+..||+.||+++.++|.++|+++
T Consensus       314 dRIFs~v-~r~-~~~~~eGrmdykdFv~FilA~e~k~t~~SleYwFrclDld~~G~Lt~~el~~fyeeq~~rm~~~~~e~  391 (493)
T KOG2562|consen  314 DRIFSQV-PRG-FTVKVEGRMDYKDFVDFILAEEDKDTPASLEYWFRCLDLDGDGILTLNELRYFYEEQLQRMECMGQEA  391 (493)
T ss_pred             HHHHhhc-ccc-ceeeecCcccHHHHHHHHHHhccCCCccchhhheeeeeccCCCcccHHHHHHHHHHHHHHHHhcCCCc
Confidence            9999944 332 12345899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHHhCCCCCCceeHHHHhcccCcchHHHhhcCHHHHHHHHhcccc-CCCCCC
Q 035581          412 LCIEDVRDEIWDMVKPADPLRITLADLLSCKQGGTVASMLIDVRGFWAHDNRENL-LQEDEE  472 (476)
Q Consensus       412 ~~~edi~~ei~d~id~~~dg~ItleeF~~~~~~~~~~n~l~d~~~f~~~e~re~~-~~~~~~  472 (476)
                      ++|+|++|||+|||+|.++++||++||++|+++++|+|+|+|+++||+||+||++ ++++.|
T Consensus       392 l~fed~l~qi~DMvkP~~~~kItLqDlk~skl~~~v~n~l~nl~kfm~~E~RE~~~~~qd~E  453 (493)
T KOG2562|consen  392 LPFEDALCQIRDMVKPEDENKITLQDLKGSKLAGTVFNILFNLNKFMAHETREPFLIRQDRE  453 (493)
T ss_pred             ccHHHHHHHHHHHhCccCCCceeHHHHhhccccchhhhhhccHHHHHHHhhhhhhhhhcccc
Confidence            9999999999999999999999999999999999999999999999999999996 555444

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only]	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00184 calmodulin; Provisional	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>PTZ00183 centrin; Provisional	Back alignment and domain information

>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism]	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only]	Back alignment and domain information

>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E	Back alignment and domain information

>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism]	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP)	Back alignment and domain information

>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>KOG4251 consensus Calcium binding protein [General function prediction only]	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z	Back alignment and domain information

>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification]	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction	Back alignment and domain information

>smart00027 EH Eps15 homology domain	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms]	Back alignment and domain information

>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11	Back alignment and domain information

>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif	Back alignment and domain information

>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]	Back alignment and domain information

>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands	Back alignment and domain information

>KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion]	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton]	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only]	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand	Back alignment and domain information

>PF14658 EF-hand_9: EF-hand domain	Back alignment and domain information

>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A	Back alignment and domain information

>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins	Back alignment and domain information

>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B	Back alignment and domain information

>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional	Back alignment and domain information

>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10	Back alignment and domain information

>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A	Back alignment and domain information

>KOG4347 consensus GTPase-activating protein VRP [General function prediction only]	Back alignment and domain information

>KOG4065 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms]	Back alignment and domain information

>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism]	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only]	Back alignment and domain information

>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A	Back alignment and domain information

>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton]	Back alignment and domain information

>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C	Back alignment and domain information

>smart00054 EFh EF-hand, calcium binding motif	Back alignment and domain information

>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only]	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms]	Back alignment and domain information

>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]	Back alignment and domain information

>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms]	Back alignment and domain information

>KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only]	Back alignment and domain information

>KOG4347 consensus GTPase-activating protein VRP [General function prediction only]	Back alignment and domain information

>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only]	Back alignment and domain information

>PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A	Back alignment and domain information

>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes	Back alignment and domain information

>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]	Back alignment and domain information

>KOG4004 consensus Matricellular protein Osteonectin/SPARC/BM-40 [Extracellular structures]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		476
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-08
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	5e-06
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	6e-06
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	7e-06
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	1e-05
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	1e-05
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	2e-05
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	2e-05
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	4e-05
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	4e-05
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	6e-05
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	6e-05
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	6e-05
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	7e-05
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	2e-04
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	3e-04
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	4e-04
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	4e-04
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	5e-04
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	5e-04
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	6e-04
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	6e-04
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	7e-04
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 54.5 bits (130), Expect = 5e-08
 Identities = 83/550 (15%), Positives = 150/550 (27%), Gaps = 187/550 (34%)

Query: 47  ELETKRILLDIFREKQQKSAEA----------GTIPSFYKKKPEEGS------ISHR--- 87
            +     L      KQ++  +             + S  K +  + S      I  R   
Sbjct: 60  AVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRL 119

Query: 88  ---VQRLAKY---RFLKKQSDL---LLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFC 138
               Q  AKY   R L+    L   LL      A  V      +ID   G+ K       
Sbjct: 120 YNDNQVFAKYNVSR-LQPYLKLRQALLELR--PAKNV------LIDGVLGSGKT-----W 165

Query: 139 HIASVCTEQIGPKCRRFFSPS--NFMKFEKDESGRIAILPFYLYVMRTVSLTQARID--- 193
               VC      +C+  F     N       E+           V+  +     +ID   
Sbjct: 166 VALDVCLSY-KVQCKMDFKIFWLNLKNCNSPET-----------VLEMLQKLLYQIDPNW 213

Query: 194 MSELDEDSDGFLQPHEMEAYIRGLIP------SLAQLRDMPTGFIQMYCRIAAHKFFFFC 247
            S  D  S+  L+ H ++A +R L+        L  L ++            A  F   C
Sbjct: 214 TSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKA-----WNA--FNLSC 266

Query: 248 DPHRRGKACIKKVLL-------SNCLQELMELHQESEEEV---TDTEQAE---NWFSLTS 294
                      K+LL       ++ L      H   +      T  E       +     
Sbjct: 267 -----------KILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRP 315

Query: 295 AQ----------RVCDMFIALDKDANGTLSKQELREYADGTLTEIFIERVFD-----EHV 339
                       R   +     +D   T      +      LT I IE   +     E+ 
Sbjct: 316 QDLPREVLTTNPRRLSIIAESIRDGLATW--DNWKHVNCDKLTTI-IESSLNVLEPAEY- 371

Query: 340 RRGKSGGGNAREMDFDNFLDF---------VLAL-----ENKDTPEGLTYLFRSLDLQER 385
                     R+M FD    F         +L+L        D    +  L +   ++++
Sbjct: 372 ----------RKM-FDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQ 420

Query: 386 GYLTTADIHSLFRD----------VHQKWIEGGNYEL----CIEDVRDEIWD-------- 423
              +T  I S++ +          +H+  ++  +Y +      +D+     D        
Sbjct: 421 PKESTISIPSIYLELKVKLENEYALHRSIVD--HYNIPKTFDSDDLIPPYLDQYFYSHIG 478

Query: 424 -------MVKPADPLRITLADL-----------LSCKQGGTVASMLIDVRGFWAHDNREN 465
                    +     R+   D             +    G++ + L  ++ +     +  
Sbjct: 479 HHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFY-----KPY 533

Query: 466 LLQEDEEPEE 475
           +   D + E 
Sbjct: 534 ICDNDPKYER 543

PyMOL of 1vt4

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		476
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	99.87
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	99.86
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	99.83
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	99.83
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.8
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	99.78
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.77
2f33_A		263	Calbindin; EF-hand, Ca2+-binding, metal binding pr	99.77
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	99.77
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	99.77
2be4_A		272	Hypothetical protein LOC449832; DR.36843, BC083168	99.76
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	99.76
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	99.76
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	99.76
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	99.75
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	99.75
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.75
1ij5_A		323	Plasmodial specific LAV1-2 protein; fourty kDa cal	99.75
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	99.75
2jnf_A		158	Troponin C; stretch activated muscle contraction,	99.75
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	99.74
3fwb_A		161	Cell division control protein 31; gene gating, com	99.74
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	99.74
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	99.73
1y1x_A		191	Leishmania major homolog of programmed cell death	99.73
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	99.73
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	99.73
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	99.73
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	99.72
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	99.72
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	99.71
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	99.71
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	99.71
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	99.71
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	99.71
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	99.71
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	99.71
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	99.7
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	99.7
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	99.7
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	99.7
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	99.69
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	99.69
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	99.69
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	99.69
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	99.69
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	99.69
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	99.69
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	99.69
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	99.68
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	99.68
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	99.68
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	99.68
1qxp_A		900	MU-like calpain; M-calpain, MU-calpain, catalytic	99.68
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	99.68
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	99.68
3sjs_A		220	URE3-BP sequence specific DNA binding protein; EF-	99.68
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	99.67
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	99.67
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	99.67
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	99.67
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	99.66
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	99.66
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	99.66
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	99.65
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	99.65
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	99.65
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	99.65
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	99.65
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	99.65
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	99.65
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	99.65
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	99.64
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	99.63
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	99.63
2znd_A		172	Programmed cell death protein 6; penta-EF-hand pro	99.63
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	99.63
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	99.63
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	99.63
1y1x_A		191	Leishmania major homolog of programmed cell death	99.63
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	99.62
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	99.62
2obh_A		143	Centrin-2; DNA repair complex EF hand superfamily	99.61
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	99.61
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	99.61
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	99.61
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	99.6
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	99.6
1bjf_A		193	Neurocalcin delta; calcium-binding, myristoylation	99.59
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	99.59
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	99.59
2lmt_A		148	Calmodulin-related protein 97A; spermatogenesis, m	99.59
1gjy_A		167	Sorcin, CP-22, V19; calcium binding, calcium-bindi	99.58
1exr_A		148	Calmodulin; high resolution, disorder, metal trans	99.58
2lhi_A		176	Calmodulin, serine/threonine-protein phosphatase c	99.58
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	99.57
1alv_A		173	Calpain, S-camld; calcium binding, calmodulin like	99.57
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	99.57
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	99.57
3akb_A		166	Putative calcium binding protein; EF-hand, metal b	99.57
1juo_A		198	Sorcin; calcium-binding proteins, penta-EF-hand, P	99.56
1k94_A		165	Grancalcin; penta-EF-hand protein, calcium binding	99.56
3qrx_A		169	Centrin; calcium-binding, EF-hand, cell division,	99.56
3fwb_A		161	Cell division control protein 31; gene gating, com	99.54
3dd4_A		229	KV channel-interacting protein 4; EF-hands protein	99.53
2f2o_A		179	Calmodulin fused with calmodulin-binding domain of	99.53
4ds7_A		147	Calmodulin, CAM; protein binding, metal binding, s	99.53
2bl0_C		142	Myosin regulatory light chain; muscle protein, sli	99.53
1dtl_A		161	Cardiac troponin C; helix-turn-helix, structural p	99.52
3i5g_C		159	Myosin catalytic light chain LC-1, mantle muscle;	99.52
3ox6_A		153	Calcium-binding protein 1; EF-hand, calcium-sensor	99.51
3mse_B		180	Calcium-dependent protein kinase, putative; CDPKS,	99.51
2ccm_A		191	Calexcitin; EF hand, calcium, signaling protein; 1	99.51
2d8n_A		207	Recoverin; structural genomics, NPPSFA, national p	99.51
1nya_A		176	Calerythrin; EF-hand, metal binding protein; NMR {	99.51
3khe_A		191	Calmodulin-like domain protein kinase isoform 3; c	99.5
1top_A		162	Troponin C; contractIle system protein; 1.78A {Gal	99.5
3u0k_A		440	Rcamp; fluorescent protein, calcium binding, EF-ha	99.5
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	99.5
1m45_A		148	MLC1P, myosin light chain; protein-peptide complex	99.5
2l2e_A		190	Calcium-binding protein NCS-1; NCS1P, myristoylate	99.5
2i7a_A		174	Calpain 13; calcium-dependent cytoplasmic cysteine	99.5
2jnf_A		158	Troponin C; stretch activated muscle contraction,	99.49
2mys_C		149	Myosin; muscle protein, motor protein; HET: MLY; 2	99.48
1qv0_A		195	Obelin, OBL; photoprotein, bioluminescence, atomic	99.48
3pm8_A		197	PFCDPK2, calcium-dependent protein kinase 2; malar	99.47
1uhk_A		191	Aequorin 2, aequorin; EF-hand motif, complex, lumi	99.47
2hps_A		186	Coelenterazine-binding protein with bound coelent;	99.47
2jul_A		256	Calsenilin; EF-hand, calcium, LXXLL, DNA binding p	99.46
1g8i_A		190	Frequenin, neuronal calcium sensor 1; calcium bind	99.45
3e3r_A		204	Calcyphosin, calcyphosine; human calcyphosine, EF-	99.45
1q80_A		174	SCP, sarcoplasmic calcium-binding protein; all-alp	99.45
2ovk_C		159	Myosin catalytic light chain LC-1, mantle muscle,	99.45
2sas_A		185	Sarcoplasmic calcium-binding protein; 2.40A {Branc	99.45
1s1e_A		224	KV channel interacting protein 1; kchip, calcium-b	99.44
3i5g_B		153	Myosin regulatory light chain LC-2, mantle muscle;	99.44
2l4h_A		214	Calcium and integrin-binding protein 1; metal bind	99.44
2bec_A		202	Calcineurin B homologous protein 2; calcineurin-ho	99.44
1jfj_A		134	Ehcabp, calcium-binding protein; EF-hand, helix-lo	99.43
1wdc_C		156	Scallop myosin; calcium binding protein, muscle pr	99.43
3j04_B		143	Myosin regulatory light chain 2, smooth muscle MA	99.43
1w7j_B		151	Myosin light chain 1; motor protein, unconventiona	99.43
1fpw_A		190	Yeast frequenin, calcium-binding protein NCS-1; EF	99.43
2mys_B		166	Myosin; muscle protein, motor protein; HET: MLY; 2	99.42
2aao_A		166	CDPK, calcium-dependent protein kinase, isoform AK	99.42
2hpk_A		208	Photoprotein berovin; structural genomics, PSI, pr	99.42
3ll8_B		155	Calcineurin subunit B type 1; protein-peptide dock	99.42
1s6c_A		183	KV4 potassium channel-interacting protein kchip1B;	99.41
1ggw_A		140	Protein (CDC4P); light chain, cytokinesis, cell cy	99.4
3k21_A		191	PFCDPK3, calcium-dependent protein kinase 3; calci	99.39
2lvv_A		226	Flagellar calcium-binding protein TB-24; EF-hand,	99.39
3lij_A		494	Calcium/calmodulin dependent protein kinase with A	99.39
2bl0_B		145	Myosin regulatory light chain; muscle protein, sli	99.39
3q5i_A		504	Protein kinase; CDPK, malaria, phosphotransferase,	99.38
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	99.37
2ehb_A		207	Calcineurin B-like protein 4; protein complex, Ca(	99.37
1s6i_A		188	CDPK, calcium-dependent protein kinase SK5; EF-han	99.37
2zfd_A		226	Calcineurin B-like protein 2; calcium binding prot	99.36
2ovk_B		153	RLC, myosin regulatory light chain LC-2, mantle mu	99.36
2r2i_A		198	Guanylyl cyclase-activating protein 1; EF hand, GC	99.36
1jba_A		204	GCAP-2, protein (guanylate cyclase activating prot	99.36
2ct9_A		208	Calcium-binding protein P22; EF-hand, metal bindin	99.35
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	99.35
3nyv_A		484	Calmodulin-domain protein kinase 1; serine/threoni	99.34
3dtp_E		196	RLC, myosin regulatory light chain; muscle protein	99.34
3bow_A		714	Calpain-2 catalytic subunit; cysteine protease, in	99.34
1wdc_B		156	Scallop myosin; calcium binding protein, muscle pr	99.32
3cs1_A		219	Flagellar calcium-binding protein; myristoylated,	99.32
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	99.32
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	99.31
3sg6_A		450	Gcamp2, myosin light chain kinase, green fluoresce	99.31
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	99.31
1dgu_A		183	Calcium-saturated CIB; helical, EF-hands, blood cl	99.31
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	99.3
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	99.3
2hps_A		186	Coelenterazine-binding protein with bound coelent;	99.3
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	99.29
2ggz_A		211	Guanylyl cyclase-activating protein 3; EF hand, gu	99.28
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	99.25
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	99.25
2qac_A		146	Myosin A tail domain interacting protein MTIP; mal	99.24
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	99.2
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.19
3a8r_A		179	Putative uncharacterized protein; EF-hand, membran	99.18
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	99.18
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	99.13
3mwu_A		486	Calmodulin-domain protein kinase 1; serine/threoni	99.11
3h4s_E		135	KCBP interacting Ca2+-binding protein; kinesin, mo	99.03
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	99.02
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	98.99
3fs7_A		109	Parvalbumin, thymic; calcium-binding protein, EF-h	98.98
2pvb_A		108	Protein (parvalbumin); calcium binding protein, me	98.96
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	98.96
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	98.95
1bu3_A		109	Calcium-binding protein; 1.65A {Merluccius bilinea	98.94
1rwy_A		109	Parvalbumin alpha; EF-hand, calcium-binding, calci	98.93
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.93
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	98.93
1rro_A		108	RAT oncomodulin; calcium-binding protein; 1.30A {R	98.92
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	98.9
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	98.9
1pva_A		110	Parvalbumin; calcium binding; 1.65A {Esox lucius}	98.9
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	98.85
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	98.82
3a4u_B		143	Multiple coagulation factor deficiency protein 2;	98.8
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	98.79
5pal_A		109	Parvalbumin; calcium-binding protein; 1.54A {Triak	98.78
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	98.75
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	98.71
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	98.7
2lv7_A		100	Calcium-binding protein 7; metal binding protein;	98.68
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	98.68
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	98.67
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	98.66
2kyc_A		108	Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p	98.63
1c07_A		95	Protein (epidermal growth factor receptor pathway	98.63
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.62
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.62
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	98.6
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	98.59
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	98.59
1s6j_A		87	CDPK, calcium-dependent protein kinase SK5; EF-han	98.58
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	98.55
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	98.53
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	98.53
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	98.53
4drw_A		121	Protein S100-A10/annexin A2 chimeric protein; atyp	98.52
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.51
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	98.51
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.51
3li6_A		66	Calcium-binding protein; calcium signaling protein	98.51
2b1u_A		71	Calmodulin-like protein 5; CLSP, calmodulin-like S	98.49
3n22_A		98	Protein S100-A2; EF-hand, calcium-binding, zinc-bi	98.48
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	98.48
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.48
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	98.46
2kz2_A		94	Calmodulin, CAM; TR2C, metal binding protein; NMR	98.46
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	98.46
2opo_A		86	Polcalcin CHE A 3; calcium-binding protein, dimer,	98.46
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	98.46
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	98.45
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	98.45
1tiz_A		67	Calmodulin-related protein, putative; helix-turn-h	98.44
3nso_A		101	Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta	98.43
1k9u_A		78	Polcalcin PHL P 7; pollen allergen, calcium-bindin	98.43
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	98.41
2jjz_A		150	Ionized calcium-binding adapter molecule 2; EF-han	98.41
2joj_A		77	Centrin protein; N-terminal domain, centrin soluti	98.41
2ktg_A		85	Calmodulin, putative; ehcam, Ca-binding protein, p	98.41
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	98.4
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.4
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	98.4
2kn2_A		92	Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco	98.4
1avs_A		90	Troponin C; muscle contraction, calcium-activated,	98.4
1c7v_A		81	CAVP, calcium vector protein; EF-hand family, calc	98.4
1fi6_A		92	EH domain protein REPS1; EPS15 homology domain, EF	98.39
1c07_A		95	Protein (epidermal growth factor receptor pathway	98.39
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.38
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	98.38
4eto_A		93	Protein S100-A4; calcium-binding protein, EF-hand,	98.38
1qjt_A		99	EH1, epidermal growth factor receptor substrate su	98.38
3li6_A		66	Calcium-binding protein; calcium signaling protein	98.38
3zwh_A		104	Protein S100-A4; Ca-binding protein-motor protein	98.38
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	98.37
2pmy_A		91	RAS and EF-hand domain-containing protein; rasef,	98.36
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	98.36
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	98.34
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.33
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.33
1wlz_A		105	DJBP, CAP-binding protein complex interacting prot	98.33
2lnk_A		113	Protein S100-A4; EF-hand, calcium binding, all alp	98.31
1qx2_A		76	Vitamin D-dependent calcium-binding protein, INTE;	98.29
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.29
2kgr_A		111	Intersectin-1; structure, alternative splicing, ca	98.28
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.28
1yx7_A		83	Calsensin, LAN3-6 antigen; calcium-binding protein	98.27
2wcb_A		95	Protein S100-A12; calcium signalling, HOST-parasit	98.27
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	98.27
2y5i_A		99	S100Z, S100 calcium binding protein Z; metal-bindi	98.26
1iq3_A		110	Ralbp1-interacting protein (partner of ralbp1); EF	98.26
3nxa_A		100	Protein S100-A16; S100 family, calcium binding pro	98.26
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.26
2d58_A		107	Allograft inflammatory factor 1; EF-hand, metal bi	98.24
1j7q_A		86	CAVP, calcium vector protein; EF-hand family, calc	98.24
1j55_A		95	S-100P protein; metal binding protein; 2.00A {Homo	98.24
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.23
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.23
2h2k_A		106	Protein S100-A13; calcium binding protein, metal b	98.22
3rm1_A		92	Protein S100-B; alpha-helical, EF hand, metal bind	98.21
1k2h_A		93	S100A1, S-100 protein, alpha chain; non-covalent h	98.21
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.19
1xk4_A		93	Calgranulin A; S100 family, heterotetramer, metal	98.19
2jq6_A		139	EH domain-containing protein 1; metal binding prot	98.19
2kax_A		92	Protein S100-A5; EF-hand, calcium binding protien,	98.18
1h8b_A		75	ACT-EF34, alpha-actinin 2, skeletal muscle isoform	98.17
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	98.17
1eh2_A		106	EPS15; calcium binding, signaling domain, NPF bind	98.15
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.14
1xk4_C		113	Calgranulin B; S100 family, heterotetramer, metal	98.13
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	98.13
1cb1_A		78	Calbindin D9K; calcium-binding protein; NMR {Sus s	98.13
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	98.11
1sra_A		151	Sparc; extracellular matrix protein, calcium-bindi	98.07
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	98.06
1k8u_A		90	S100A6, calcyclin, CACY; calcium regulatory protei	98.06
1qls_A		99	S100C protein, calgizzarin; metal-binding protein/	98.05
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	98.05
1wy9_A		147	Allograft inflammatory factor 1; EF-hand, calucium	98.04
1psr_A		100	Psoriasin, S100A7; EF-hand protein, MAD phasing, p	98.0
1snl_A		103	Nucleobindin 1, calnuc; EF-hand, calcium-binding,	97.99
1a4p_A		96	S100A10; S100 family, EF-hand protein, ligand of a	97.93
2kld_A		123	Polycystin-2; PC2, PKD2, calcium binding domain, E	97.75
3fia_A		121	Intersectin-1; EH 1 domain, NESG, structural genom	97.69
1tuz_A		118	Diacylglycerol kinase alpha; transferase, HR532, n	97.26
1nub_A		229	Basement membrane protein BM-40; extracellular mod	97.23
1nub_A		229	Basement membrane protein BM-40; extracellular mod	97.13
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	88.61
1pul_A		125	Hypothetical protein C32E8.3 in chromosome I; alph	86.17
2qpt_A		550	EH domain-containing protein-2; protein-nucleotide	85.03

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

Probab=99.87  E-value=1e-21  Score=189.13  Aligned_cols=219  Identities=15%  Similarity=0.222  Sum_probs=161.7

Q ss_pred             hhhhhhhccccCCCCCCCCHHHHHHHHHHHchhccc-CCCCChhhHHHHHHHHHHHHhhhcCCCCCCcccHHHHHhhhhH
Q 035581          188 TQARIDMSELDEDSDGFLQPHEMEAYIRGLIPSLAQ-LRDMPTGFIQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCL  266 (476)
Q Consensus       188 ~q~r~~f~~yD~d~~G~I~~~Dl~~~i~~li~~~p~-l~~l~p~F~~~Y~~~vv~rif~~lD~~~dGrIti~Ef~~s~~l  266 (476)
                      .+++-+|..+|.+++|+|+..||..+++.+...+.. -....         ..+.++|..+|.+++|.|++.||+..-..
T Consensus        16 ~~l~~~F~~~D~d~~G~i~~~El~~~l~~l~~~~~~~~~~~~---------~~~~~l~~~~D~~~~g~i~~~Ef~~~~~~   86 (263)
T 2f33_A           16 SQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELS---------PEMKTFVDQYGQRDDGKIGIVELAHVLPT   86 (263)
T ss_dssp             HHHHHHHHHHCTTCSSSBCSHHHHHHHHHHHHHHHHHTCCCC---------HHHHHHHHHHTTGGGCCBCHHHHHHHTTS
T ss_pred             HHHHHHHHHhCCCCCCCcCHHHHHHHHHHHHhhcCCCccchH---------HHHHHHHHHhCCCCCCcCcHHHHHHHHhh
Confidence            356778999999999999999999999987433211 01111         35788999999999999999999863100


Q ss_pred             -HHH-HHhchhchhhhhhhhhhcCCCCHHHHHHHHHHHhhhCCCCCCcccHHHHHHhh-------CCCCCHHHHHH----
Q 035581          267 -QEL-MELHQESEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQELREYA-------DGTLTEIFIER----  333 (476)
Q Consensus       267 -~~l-~~l~~~~ee~~~~~~~~~~~FS~~~~~~l~~~F~~lD~D~dG~Is~~EL~~~~-------~~~~t~~~i~r----  333 (476)
                       ... ....            ....   .....+...|..+|+|++|.|+.+||..++       +..+++..+..    
T Consensus        87 ~~~~~~~~~------------~~~~---~~~~~l~~~F~~~D~d~~G~i~~~el~~~l~~~~~~~g~~~~~~~~~~~~~~  151 (263)
T 2f33_A           87 EENFLLLFR------------CQQL---KSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDL  151 (263)
T ss_dssp             CTTHHHHHG------------GGTS---SCHHHHHHHHTTSSTTTCSSBCHHHHHHHHHHHHHHHTSCCCHHHHHHHHHH
T ss_pred             hhhHHHHHH------------Hhhc---cHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHHHHhhcCCCCCHHHHHHHHHH
Confidence             000 0000            0000   112357889999999999999999998764       66788888876    


Q ss_pred             HHHHhhccCCCCCCCCCcccHHHHHHHHHHc--------cCCCCHHHHHHHhHhhcCCCCCcccHHHHHHHHHHHHHHHh
Q 035581          334 VFDEHVRRGKSGGGNAREMDFDNFLDFVLAL--------ENKDTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWI  405 (476)
Q Consensus       334 if~~~d~~~~~~~~~dG~Idf~eFl~fll~~--------e~~~~~~~l~~~F~ilD~DgdG~Is~~EL~~f~~~i~~~l~  405 (476)
                      +|..++.++      +|.|+|.||+.++...        ........++.+|+.+|.|++|+||..||..+++.+.... 
T Consensus       152 ~~~~~d~~~------dg~i~~~ef~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~D~d~~G~is~~El~~~l~~~~~~~-  224 (263)
T 2f33_A          152 MLKLFDSNN------DGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKN-  224 (263)
T ss_dssp             HHHHTCSSS------SSCBCHHHHHHHSCTTTCSHHHHHHTCCCHHHHHHHHHHHCCSSSSCEEHHHHHHHHHHHHHHC-
T ss_pred             HHHhcCCCC------CCeEcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHhCCCCCCcccHHHHHHHHHHHHHhc-
Confidence            888887764      8999999999987431        2334567899999999999999999999999987765421 


Q ss_pred             hcCCCCCCHHHHHHHHHHH-hCCCCCCceeHHHHhcc
Q 035581          406 EGGNYELCIEDVRDEIWDM-VKPADPLRITLADLLSC  441 (476)
Q Consensus       406 ~~g~~~~~~edi~~ei~d~-id~~~dg~ItleeF~~~  441 (476)
                        + ..++.++ +.+++.. ++.+++|.|+|+||++.
T Consensus       225 --~-~~~~~~e-~~~~~~~~~D~d~dG~i~~~EF~~~  257 (263)
T 2f33_A          225 --K-QELDINN-ISTYKKNIMALSDGGKLYRTDLALI  257 (263)
T ss_dssp             --T-TTCCTTT-HHHHHHHHHTTSBTTEECGGGTHHH
T ss_pred             --C-CCCCHHH-HHHHHHHhhccCCCCeEcHHHHHHH
Confidence              1 1344444 3667776 69999999999999986

PyMOL of 2f33

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A	Back alignment and structure

>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8	Back alignment and structure

>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ...	Back alignment and structure

>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A	Back alignment and structure

>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A	Back alignment and structure

>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A	Back alignment and structure

>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A	Back alignment and structure

>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A	Back alignment and structure

>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A	Back alignment and structure

>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A	Back alignment and structure

>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A	Back alignment and structure

>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ...	Back alignment and structure

>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C	Back alignment and structure

>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A	Back alignment and structure

>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum}	Back alignment and structure

>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii}	Back alignment and structure

>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A	Back alignment and structure

>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5	Back alignment and structure

>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii}	Back alignment and structure

>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ...	Back alignment and structure

>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor}	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A	Back alignment and structure

>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe}	Back alignment and structure

>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens}	Back alignment and structure

>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A	Back alignment and structure

>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C*	Back alignment and structure

>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A*	Back alignment and structure

>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1}	Back alignment and structure

>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus}	Back alignment and structure

>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A	Back alignment and structure

>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens}	Back alignment and structure

>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A	Back alignment and structure

>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5	Back alignment and structure

>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5	Back alignment and structure

>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B	Back alignment and structure

>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A	Back alignment and structure

>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens}	Back alignment and structure

>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A	Back alignment and structure

>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ...	Back alignment and structure

>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus}	Back alignment and structure

>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C	Back alignment and structure

>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A	Back alignment and structure

>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B	Back alignment and structure

>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola}	Back alignment and structure

>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B*	Back alignment and structure

>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E	Back alignment and structure

>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5	Back alignment and structure

>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A	Back alignment and structure

>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei}	Back alignment and structure

>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A*	Back alignment and structure

>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum}	Back alignment and structure

>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei}	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A	Back alignment and structure

>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A	Back alignment and structure

>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus}	Back alignment and structure

>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5	Back alignment and structure

>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A*	Back alignment and structure

>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia}	Back alignment and structure

>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L	Back alignment and structure

>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ...	Back alignment and structure

>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi}	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A*	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens}	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group}	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A*	Back alignment and structure

>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana}	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A	Back alignment and structure

>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4	Back alignment and structure

>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1	Back alignment and structure

>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens}	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus}	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5	Back alignment and structure

>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A	Back alignment and structure

>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A	Back alignment and structure

>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus}	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max}	Back alignment and structure

>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A	Back alignment and structure

>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A	Back alignment and structure

>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A*	Back alignment and structure

>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6	Back alignment and structure

>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica}	Back alignment and structure

>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens}	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens}	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A	Back alignment and structure

>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A	Back alignment and structure

>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens}	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A	Back alignment and structure

>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio}	Back alignment and structure

>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6	Back alignment and structure

>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens}	Back alignment and structure

>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A	Back alignment and structure

>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A	Back alignment and structure

>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ...	Back alignment and structure

>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A	Back alignment and structure

>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A	Back alignment and structure

>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A*	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A	Back alignment and structure

>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A	Back alignment and structure

>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A	Back alignment and structure

>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A	Back alignment and structure

>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A	Back alignment and structure

>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A	Back alignment and structure

>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A*	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11	Back alignment and structure

>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		476
d1fpwa_		190	a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1	9e-05
d1jfja_		134	a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly	0.002
d1bjfa_		181	a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId	0.002
d1qxpa2		188	a.39.1.8 (A:515-702) Calpain large subunit, C-term	0.004

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190	Back information, alignment and structure


class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Frequenin (neuronal calcium sensor 1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 41.0 bits (95), Expect = 9e-05
 Identities = 24/158 (15%), Positives = 56/158 (35%), Gaps = 13/158 (8%)

Query: 276 SEEEVTDTEQAENWFSLTSAQRVCDMFIALDKDANGTLSKQE----LREYADGTLTEIFI 331
           S++++T  +Q+   F     Q+    F+       G L++++     +++      E F 
Sbjct: 9   SKDDLTCLKQSTY-FDRREIQQWHKGFLRDCPS--GQLAREDFVKIYKQFFPFGSPEDFA 65

Query: 332 ERVFDEHVRRGKSGGGNAREMDFDNFLDFVLALENKDTPEGLTYLFRSLDLQERGYLTTA 391
             +F    +           + F+ F+  +         E L++ F   DL   GY+T  
Sbjct: 66  NHLFTVFDKDNN------GFIHFEEFITVLSTTSRGTLEEKLSWAFELYDLNHDGYITFD 119

Query: 392 DIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPAD 429
           ++ ++   V++                  +  + K  D
Sbjct: 120 EMLTIVASVYKMMGSMVTLNEDEATPEMRVKKIFKLMD 157

PyMOL of d1fpwa_

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		476
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	99.78
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	99.76
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	99.75
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	99.75
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	99.75
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	99.75
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	99.73
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	99.73
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	99.72
d1omra_		201	Recoverin {Cow (Bos taurus) [TaxId: 9913]}	99.72
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	99.71
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	99.7
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	99.7
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	99.7
d1fpwa_		190	Frequenin (neuronal calcium sensor 1) {Baker's yea	99.69
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.69
d1g8ia_		187	Frequenin (neuronal calcium sensor 1) {Human (Homo	99.69
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	99.68
d1s6ca_		178	Kchip1, Kv4 potassium channel-interacting protein	99.67
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	99.67
d1jbaa_		189	Guanylate cyclase activating protein 2, GCAP-2 {Co	99.66
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.66
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	99.65
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	99.64
d1bjfa_		181	Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	99.64
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	99.64
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	99.64
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	99.63
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	99.63
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	99.63
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	99.63
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.62
d2zfda1		183	Calcineurin B-like protein 2 {Thale cress (Arabido	99.62
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	99.61
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	99.6
d1xo5a_		180	Calcium- and integrin-binding protein, CIB {Human	99.59
d1ij5a_		321	Cbp40 (plasmodial specific CaII-binding protein LA	99.59
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	99.58
d1hqva_		181	Apoptosis-linked protein alg-2 {Mouse (Mus musculu	99.58
d1exra_		146	Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI	99.57
d1y1xa_		182	Programmed cell death 6 protein-like protein {Leis	99.56
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	99.55
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	99.55
d1jfja_		134	EHCABP {Entamoeba (Entamoeba histolytica) [TaxId:	99.53
d2obha1		141	Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	99.51
d1topa_		162	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.5
d2mysc_		145	Myosin Regulatory Chain {Chicken (Gallus gallus) [	99.5
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	99.46
d1k94a_		165	Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	99.46
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	99.46
d1lkja_		146	Calmodulin {Baker's yeast (Saccharomyces cerevisia	99.45
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	99.44
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	99.44
d1ggwa_		140	Cdc4p {Fission yeast (Schizosaccharomyces pombe) [	99.43
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	99.43
d1dtla_		156	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	99.42
d1wdcb_		142	Myosin Essential Chain {Bay scallop (Aequipecten i	99.42
d1wdcc_		152	Myosin Regulatory Chain {Bay scallop (Aequipecten	99.41
d1df0a1		186	Calpain large subunit, C-terminal domain (domain I	99.41
d1alva_		173	Calpain small (regulatory) subunit (domain VI) {Pi	99.41
d1m45a_		146	Myosin Light Chain Mlc1p {Baker's yeast (Saccharom	99.4
d1auib_		165	Calcineurin regulatory subunit (B-chain) {Human (H	99.4
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	99.4
d2scpa_		174	Sarcoplasmic calcium-binding protein {Sandworm (Ne	99.38
d2sasa_		185	Sarcoplasmic calcium-binding protein {Amphioxus (B	99.38
d1juoa_		172	Sorcin {Human (Homo sapiens) [TaxId: 9606]}	99.37
d1qxpa2		188	Calpain large subunit, C-terminal domain (domain I	99.37
d1uhka1		187	Calcium-regulated photoprotein {Jellyfish (Aequore	99.36
d1qv0a_		189	Calcium-regulated photoprotein {Hydrozoa (Obelia l	99.35
d2mysb_		145	Myosin Essential Chain {Chicken (Gallus gallus) [T	99.34
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.34
d1nyaa_		176	Calerythrin {Saccharopolyspora erythraea [TaxId: 1	99.33
d1w7jb1		139	Myosin Essential Chain {Human (Homo sapiens) [TaxI	99.32
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	99.29
d1s6ia_		182	Calcium-dependent protein kinase sk5 CLD {Soybean	99.24
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	99.22
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	99.11
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	99.07
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	99.0
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.99
d5pala_		109	Parvalbumin {Leopard shark (Triakis semifasciata)	98.98
d1pvaa_		109	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.96
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.96
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	98.95
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	98.9
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	98.86
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	98.86
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.85
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	98.83
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	98.83
d1fi5a_		81	Troponin C {Chicken (Gallus gallus), cardiac isofo	98.83
d2pvba_		107	Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	98.82
d1jc2a_		75	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.82
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	98.81
d1fw4a_		65	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	98.8
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	98.77
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	98.76
d1oqpa_		77	Caltractin (centrin 2) {Green algae (Chlamydomonas	98.75
d1rroa_		108	Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116	98.75
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	98.75
d2fcea1		61	Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	98.73
d1tiza_		67	Calmodulin-related protein T21P5.17 {Thale cress (	98.72
d1c7va_		68	Calcium vector protein {Amphioxus (Branchiostoma l	98.71
d1s6ja_		87	Calcium-dependent protein kinase sk5 CLD {Soybean	98.71
d1rwya_		109	Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	98.7
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.69
d1avsa_		81	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	98.67
d2opoa1		81	Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta	98.65
d1f54a_		77	Calmodulin {Baker's yeast (Saccharomyces cerevisia	98.65
d2zkmx1		170	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	98.62
d2pq3a1		73	Calmodulin {Rattus norvegicus [TaxId: 10116]}	98.6
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	98.58
d1snla_		99	Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax	98.56
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.55
d1wrka1		82	Troponin C {Human (Homo sapiens), cardiac isoform	98.52
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.52
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	98.45
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.42
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	98.36
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.35
d1wlza1		83	DJ-1-binding protein, DJBP {Human (Homo sapiens) [	98.34
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.33
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.32
d1qx2a_		76	Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	98.25
d1c07a_		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.24
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	98.24
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	98.2
d1fi6a_		92	Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	98.18
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	98.18
d1zfsa1		93	Calcyclin (S100) {Rat (Rattus norvegicus), s100a1	98.15
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.14
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	98.12
d1a4pa_		92	Calcyclin (S100) {Human (Homo sapiens), P11 s100a1	98.1
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	98.08
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	98.05
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	98.02
d1cb1a_		78	Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	98.02
d1yuta1		98	Calcyclin (S100) {Human (Homo sapiens), s100a13 [T	98.01
d2jxca1		95	Eps15 {Human (Homo sapiens) [TaxId: 9606]}	98.0
d3c1va1		93	Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta	97.98
d1qjta_		99	Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	97.98
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	97.96
d1ksoa_		93	Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta	97.91
d1iq3a_		110	Pob1 {Human (Homo sapiens) [TaxId: 9606]}	97.88
d1tuza_		118	Diacylglycerol kinase alpha, N-terminal domain {Hu	97.82
d1psra_		100	Calcyclin (S100) {Human (Homo sapiens), psoriasin	97.72
d1xk4a1		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	97.65
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	97.56
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	97.53
d1k8ua_		89	Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta	97.47
d1e8aa_		87	Calcyclin (S100) {Human (Homo sapiens), calgranuli	97.44
d2hf5a1		33	Troponin C {Human (Homo sapiens), cardiac isoform	97.26
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	97.24
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	96.91
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	96.64
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	96.1
d1sraa_		151	C-terminal (EC) domain of BM-40/SPARC/osteonectin	95.85
d3cr5x1		90	Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId:	95.32
d1ctda_		34	Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	95.2
d1qlsa_		95	Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1	94.71
d1xk4c1		83	Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr	94.64
d1j55a_		94	Calcyclin (S100) {Human (Homo sapiens), s100p [Tax	93.84
d1qasa1		94	Phosphoinositide-specific phospholipase C, isozyme	88.91
d1eg3a2		97	Dystrophin {Human (Homo sapiens) [TaxId: 9606]}	88.01
d1h8ba_		73	alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	86.59
d1eg3a1		125	Dystrophin {Human (Homo sapiens) [TaxId: 9606]}	81.84
d1h8ba_		73	alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	81.82

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calcium- and integrin-binding protein, CIB
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.78  E-value=3.7e-19  Score=162.91  Aligned_cols=161  Identities=15%  Similarity=0.208  Sum_probs=123.0

Q ss_pred             hhcCCCCHHHHHHHHHHHhhhCCCCCCc--------ccHHHHHHhhCCCCCHHHHHHHHHHhhccCCCCCCCCCcccHHH
Q 035581          285 QAENWFSLTSAQRVCDMFIALDKDANGT--------LSKQELREYADGTLTEIFIERVFDEHVRRGKSGGGNAREMDFDN  356 (476)
Q Consensus       285 ~~~~~FS~~~~~~l~~~F~~lD~D~dG~--------Is~~EL~~~~~~~~t~~~i~rif~~~d~~~~~~~~~dG~Idf~e  356 (476)
                      +..++||.+++.++|.+|..+|.+++|.        |+.+++..+.+...++ .++|||..++.+.     ++|.|+|.|
T Consensus         6 ~~~T~ft~~EI~~l~~~F~~l~~~~~~~~~~~~~~~i~~~e~~~~~~l~~~~-~~~rif~~fd~~~-----~~g~I~f~E   79 (180)
T d1xo5a_           6 QDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANP-FKERICRVFSTSP-----AKDSLSFED   79 (180)
T ss_dssp             SCCCCSCHHHHHHHHHHHHTTSCGGGCSHHHHHHCCEEHHHHHTSHHHHTCT-THHHHHHHHCCST-----TCCEECHHH
T ss_pred             HHhcCCCHHHHHHHHHHHHHHCcCccccccccccceEcHHHHhcCcccccCh-HHHHHHHhccCCC-----CCCcCcHHH
Confidence            4568999999999999999998888766        5566665543322222 5789999998652     379999999


Q ss_pred             HHHHHHHccCC-CCHHHHHHHhHhhcCCCCCcccHHHHHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHhCCCCCCceeH
Q 035581          357 FLDFVLALENK-DTPEGLTYLFRSLDLQERGYLTTADIHSLFRDVHQKWIEGGNYELCIEDVRDEIWDMVKPADPLRITL  435 (476)
Q Consensus       357 Fl~fll~~e~~-~~~~~l~~~F~ilD~DgdG~Is~~EL~~f~~~i~~~l~~~g~~~~~~edi~~ei~d~id~~~dg~Itl  435 (476)
                      |+.++...... ...+.++++|++||.||+|+|+..||..+++.+..............+++++.++..+|.++||+|++
T Consensus        80 Fv~~l~~~~~~~~~~~kl~~~F~~~D~d~~G~I~~~el~~~l~~~~~~~~~~~~~~~~~~~~v~~~~~~~D~d~dG~Is~  159 (180)
T d1xo5a_          80 FLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINL  159 (180)
T ss_dssp             HHHHHHHHSTTSCHHHHHHHHHHHHCTTCSSSBCHHHHHHHHHHHC------CCCCTTHHHHHHHHHHHHCTTCSSSBCH
T ss_pred             HHHHHHHHhhcCCHHHHHHHhhccccCCCCCeeeHHHHHHHHHHHHhccccccccHHHHHHHHHHHHHHhCCCCCCcCcH
Confidence            99988766444 44568999999999999999999999999876643222222234456888899999999999999999


Q ss_pred             HHHhcc-cCcchHHHhh
Q 035581          436 ADLLSC-KQGGTVASML  451 (476)
Q Consensus       436 eeF~~~-~~~~~~~n~l  451 (476)
                      +||++. ...+.|+++|
T Consensus       160 ~EF~~~~~~~P~~~~~f  176 (180)
T d1xo5a_         160 SEFQHVISRSPDFASSF  176 (180)
T ss_dssp             HHHHHHHHHCHHHHHHH
T ss_pred             HHHHHHHHhCHHHHhhC
Confidence            999995 5666776654

PyMOL of d1xo5a_

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}	Back information, alignment and structure

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}	Back information, alignment and structure

>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}	Back information, alignment and structure

>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]}	Back information, alignment and structure

>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]}	Back information, alignment and structure

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]}	Back information, alignment and structure

>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}	Back information, alignment and structure

>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]}	Back information, alignment and structure

>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]}	Back information, alignment and structure

>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]}	Back information, alignment and structure

>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}	Back information, alignment and structure

>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}	Back information, alignment and structure

>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]}	Back information, alignment and structure

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]}	Back information, alignment and structure

>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}	Back information, alignment and structure

>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}	Back information, alignment and structure

>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]}	Back information, alignment and structure

>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]}	Back information, alignment and structure

>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}	Back information, alignment and structure

>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]}	Back information, alignment and structure

>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}	Back information, alignment and structure

>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]}	Back information, alignment and structure

>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}	Back information, alignment and structure

>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]}	Back information, alignment and structure

>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure