Citrus Sinensis ID: 035602


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190----
ARYGVQLEKSTFERRTADFLWMMIFSSYIIAEFFFSSWDFYVLSELLALSAIPMLWTPFLGVSLVFMLLYVWSREFPTAQISIYGLVTLKAFYLPWAMLALDVIFGSPLLPNFLGIIAGHLYYFLTVLHPLAGGRNILATPRWVHKLVAFWRLGHPTNASVQPERGAGGAFTGRSYRLNLSSSRPFFPRSLWSS
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccc
*RYGVQLEKSTFERRTADFLWMMIFSSYIIAEFFFSSWDFYVLSELLALSAIPMLWTPFLGVSLVFMLLYVWSREFPTAQISIYGLVTLKAFYLPWAMLALDVIFGSPLLPNFLGIIAGHLYYFLTVLHPLAGGRNILATPRWVHKLVAFW*****T*************************************
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ARYGVQLEKSTFERRTADFLWMMIFSSYIIAEFFFSSWDFYVLSELLALSAIPMLWTPFLGVSLVFMLLYVWSREFPTAQISIYGLVTLKAFYLPWAMLALDVIFGSPLLPNFLGIIAGHLYYFLTVLHPLAGGRNILATPRWVHKLVAFWRLGHPTNASVQPERGAGGAFTGRSYRLNLSSSRPFFPRSLWSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Derlin-1 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ06397
Derlin-1 May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.probableQ8VZU9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted