Citrus Sinensis ID: 035610


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MENVWRASSGQDPNPVDYKGIEFWSQPGAIGPANKQGDYIKTWLRRWFILKQGEHFWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDVLNKPFAFEHSRGGYTMYSVADTEKEKGERINSIGRAIVQHSRSVTESEVVEYDSKW
cccHHHHHccccccccccccccccccccCEEEEEEcccccccEEEEEEEEEccEEEEEECcccccccccccCEEEcccEEEEEccccccccccEEEEECccCEEEEEcccHHHHHHHHHHHHHHHHHHccccccccEEcccccc
****************DYKGIEFWSQPGAIGPANKQGDYIKTWLRRWFILKQGEHFWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDVLNKPFAFEHSRGGYTMYSVADTEKEKGERINSIG****************EY****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENVWRASSGQDPNPVDYKGIEFWSQPGAIGPANKQGDYIKTWLRRWFILKQGEHFWFKDSHNITRGSTPRGFIPVGTCLTVKCAEDVLNKPFAFEHSRGGYTMYSVADTEKEKGERINSIGRAIVQHSRSVTESEVVEYDSKW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pleckstrin homology domain-containing protein 1 Binds specifically to phosphatidylinositol 3-phosphate (PtdIns3P), but not to other phosphoinositides.probableQ9ST43

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X05, chain A
Confidence level:very confident
Coverage over the Query: 21-128
View the alignment between query and template
View the model in PyMOL