Citrus Sinensis ID: 035649


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MGDDHHRGKVSAEANVDDSSPRVFPCLFCSRKFYSSQALGGHQNAHKKERTAARKAKRVASDHLHQYASTTPSLPPMVFAPSHHHHHMGQQLMHPSSMYISAHSSNFGYFPTQQHFASASDRSKSNGAAARFDHQNNTVNQIIGSVANADKGKDSKLDLSLHL
ccccccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccEEEccHcccccccccHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccEEEEcc
mgddhhrgkvsaeanvddssprvfpclfcsrkfyssqalgghqnahKKERTAARKAKRVAsdhlhqyasttpslppmvfapshhhhhmgqqlmhpssmyisahssnfgyfptqqhfasasdrsksngaaarfdhqnnTVNQIIGSvanadkgkdskldlslhl
mgddhhrgkvsaeanvddssprvFPCLFCSRKFYSsqalgghqnahKKERTAARKAKRVASDHLHQYASTTPSLPPMVFAPSHHHHHMGQQLMHPSSMYISAHSSNFGYFPTQQHFASASDRSKSNGAAARFDHQNNTVNQIIGsvanadkgkdskldlslhl
MGDDHHRGKVSAEANVDDSSPRVFPCLFCSRKFYSSQALGGHQNahkkertaarkakrvaSDHLHQYASTTPSLPPMVFAPShhhhhMGQQLMHPSSMYISAHSSNFGYFPTQQHFASASDRSKSNGAAARFDHQNNTVNQIIGSVANADKGKDSKLDLSLHL
**********************VFPCLFCSRKFYS********************************************************************************************************************************
************************PCLFCSRKFYSSQALGGHQNAH***************************LPPMVFAPSHHHH**********************************************************************LDLSLHL
******************SSPRVFPCLFCSRKFYSSQ***************************HQYASTTPSLPPMVFAPS*********LMHPSSMYISAHSSNFGYFPTQQH************AAARFDHQNNTVNQIIGSVANADKGKDSKLDLSLHL
********************PRVFPCLFCSRKFYSSQALGGHQNAHKKERTAARKAKRVASDHLHQYASTTPSLPPMVFAPSHHHHHMGQQLMHPSSMYISAHSSNFGYFPTQQHFASASDRSKSNGAAARFDHQNNTVNQIIGSVANADKGKDSKLDLSLHL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDDHHRGKVSAEANVDDSSPRVFPCLFCSRKFYSSQALGGHQNAHKKERTAARKAKRVASDHLHQYASTTPSLPPMVFAPSHHHHHMGQQLMHPSSMYISAHSSNFGYFPTQQHFASASDRSKSNGAAARFDHQNNTVNQIIGSVANADKGKDSKLDLSLHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query163 2.2.26 [Sep-21-2011]
Q42485228 Zinc finger protein 1 OS= no no 0.337 0.241 0.555 2e-12
Q39266209 Zinc finger protein 7 OS= no no 0.349 0.272 0.566 1e-11
Q39263260 Zinc finger protein 4 OS= no no 0.251 0.157 0.707 4e-11
Q39261150 Zinc finger protein 2 OS= no no 0.239 0.26 0.717 1e-10
Q9FFX4161 Zinc finger protein KNUCK no no 0.251 0.254 0.658 1e-10
Q39262235 Zinc finger protein 3 OS= no no 0.245 0.170 0.625 5e-10
Q39265197 Zinc finger protein 6 OS= no no 0.404 0.335 0.441 4e-08
Q6S591253 Zinc finger protein JAGGE no no 0.202 0.130 0.606 7e-05
Q38895204 Transcriptional regulator no no 0.208 0.166 0.529 7e-05
Q9LHS9226 Probable transcriptional no no 0.184 0.132 0.566 0.0001
>sp|Q42485|ZFP1_ARATH Zinc finger protein 1 OS=Arabidopsis thaliana GN=ZFP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 40/63 (63%), Gaps = 8/63 (12%)

Query: 21  PRVFPCLFCSRKFYSSQALGGHQNAHKKERTAARKAKRVASDHLHQYASTTPSLPPMVFA 80
           PRVF C +C RKFYSSQALGGHQNAHK+ERT A++ +         Y  T  SLP   FA
Sbjct: 65  PRVFSCNYCQRKFYSSQALGGHQNAHKRERTLAKRGQY--------YKMTLSSLPSSAFA 116

Query: 81  PSH 83
             H
Sbjct: 117 FGH 119





Arabidopsis thaliana (taxid: 3702)
>sp|Q39266|ZFP7_ARATH Zinc finger protein 7 OS=Arabidopsis thaliana GN=ZFP7 PE=2 SV=1 Back     alignment and function description
>sp|Q39263|ZFP4_ARATH Zinc finger protein 4 OS=Arabidopsis thaliana GN=ZFP4 PE=2 SV=2 Back     alignment and function description
>sp|Q39261|ZFP2_ARATH Zinc finger protein 2 OS=Arabidopsis thaliana GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFX4|KNU_ARATH Zinc finger protein KNUCKLES OS=Arabidopsis thaliana GN=KNU PE=1 SV=1 Back     alignment and function description
>sp|Q39262|ZFP3_ARATH Zinc finger protein 3 OS=Arabidopsis thaliana GN=ZFP3 PE=2 SV=1 Back     alignment and function description
>sp|Q39265|ZFP6_ARATH Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1 Back     alignment and function description
>sp|Q6S591|JAG_ARATH Zinc finger protein JAGGED OS=Arabidopsis thaliana GN=JAG PE=2 SV=1 Back     alignment and function description
>sp|Q38895|SUP_ARATH Transcriptional regulator SUPERMAN OS=Arabidopsis thaliana GN=SUP PE=1 SV=1 Back     alignment and function description
>sp|Q9LHS9|RBE_ARATH Probable transcriptional regulator RABBIT EARS OS=Arabidopsis thaliana GN=RBE PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
225464212183 PREDICTED: uncharacterized protein LOC10 0.840 0.748 0.435 2e-26
224065302190 predicted protein [Populus trichocarpa] 0.680 0.584 0.552 1e-24
356527409176 PREDICTED: zinc finger protein 7-like [G 0.926 0.857 0.425 2e-24
351727837176 uncharacterized protein LOC100527084 [Gl 0.926 0.857 0.414 3e-24
224132050179 predicted protein [Populus trichocarpa] 0.791 0.720 0.434 8e-22
449517385147 PREDICTED: zinc finger protein 7-like [C 0.631 0.700 0.514 2e-20
255560219199 zinc finger protein, putative [Ricinus c 0.662 0.542 0.560 6e-20
297792083173 transcription factor [Arabidopsis lyrata 0.889 0.838 0.431 1e-14
15239730173 C2H2-like zinc finger protein [Arabidops 0.889 0.838 0.431 3e-14
302398665 280 C2H2L domain class transcription factor 0.361 0.210 0.537 1e-12
>gi|225464212|ref|XP_002264981.1| PREDICTED: uncharacterized protein LOC100246047 [Vitis vinifera] gi|297744296|emb|CBI37266.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 84/193 (43%), Positives = 111/193 (57%), Gaps = 56/193 (29%)

Query: 13  EANVDDSSPRVFPCLFCSRKFYSSQALGGHQNAHKKERTAARKAKRVASDHLHQYASTTP 72
           +  ++DS+ RVFPCLFCSRKF+SSQALGGHQNAHKKERTAARKAKR +   L+ +++T P
Sbjct: 5   DKTIEDSATRVFPCLFCSRKFHSSQALGGHQNAHKKERTAARKAKRASEYTLNSFSATPP 64

Query: 73  SLPPMVFAPSHHHHHMGQQLMHPSSMYISAHSSNFG-YFPTQQHFASASDRSKSNGA--- 128
             PP+VFAPS   HH+G  + +P SMYI+AH++ F  +FPT Q     S+R  ++GA   
Sbjct: 65  --PPLVFAPS---HHLG--IFNP-SMYITAHAATFANHFPTPQF----SERFGASGAPRL 112

Query: 129 ------------AARFDHQ-----------------NNTV---------NQIIGSVANAD 150
                          + HQ                 NN +         NQ +G   + +
Sbjct: 113 ENVVFYGGGSCSGNVYQHQLGDDEQSLVNWQRSALRNNAMNGGSSQHIKNQKLG--GDIE 170

Query: 151 KGKDSKLDLSLHL 163
           + KD KLDLSLHL
Sbjct: 171 RDKDKKLDLSLHL 183




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224065302|ref|XP_002301764.1| predicted protein [Populus trichocarpa] gi|222843490|gb|EEE81037.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356527409|ref|XP_003532303.1| PREDICTED: zinc finger protein 7-like [Glycine max] Back     alignment and taxonomy information
>gi|351727837|ref|NP_001238454.1| uncharacterized protein LOC100527084 [Glycine max] gi|255631518|gb|ACU16126.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224132050|ref|XP_002321243.1| predicted protein [Populus trichocarpa] gi|222862016|gb|EEE99558.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449517385|ref|XP_004165726.1| PREDICTED: zinc finger protein 7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255560219|ref|XP_002521127.1| zinc finger protein, putative [Ricinus communis] gi|223539696|gb|EEF41278.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297792083|ref|XP_002863926.1| transcription factor [Arabidopsis lyrata subsp. lyrata] gi|297309761|gb|EFH40185.1| transcription factor [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15239730|ref|NP_199700.1| C2H2-like zinc finger protein [Arabidopsis thaliana] gi|9758888|dbj|BAB09442.1| unnamed protein product [Arabidopsis thaliana] gi|332008356|gb|AED95739.1| C2H2-like zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|302398665|gb|ADL36627.1| C2H2L domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
TAIR|locus:2156529173 LATE "LATE FLOWERING" [Arabido 0.938 0.884 0.333 1.3e-13
TAIR|locus:2825107209 ZFP7 "AT1G24625" [Arabidopsis 0.165 0.129 0.740 4.4e-07
TAIR|locus:2174547150 ZFP2 "AT5G57520" [Arabidopsis 0.208 0.226 0.605 4.8e-07
TAIR|locus:2159088161 KNU "AT5G14010" [Arabidopsis t 0.208 0.211 0.588 6.1e-07
TAIR|locus:2025777228 ZFP1 "AT1G80730" [Arabidopsis 0.159 0.114 0.769 1e-06
TAIR|locus:2181007215 AT5G01860 "AT5G01860" [Arabido 0.883 0.669 0.257 3.2e-06
TAIR|locus:2013820260 ZFP4 "AT1G66140" [Arabidopsis 0.153 0.096 0.8 5.4e-06
TAIR|locus:2183780272 AT5G10970 "AT5G10970" [Arabido 0.226 0.136 0.526 0.00011
TAIR|locus:2146960235 ZFP3 "AT5G25160" [Arabidopsis 0.141 0.097 0.695 0.00013
TAIR|locus:2156529 LATE "LATE FLOWERING" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.3e-13, P = 1.3e-13
 Identities = 53/159 (33%), Positives = 72/159 (45%)

Query:     9 KVSAEANVDD---SSPRVFPCLFCSRKFYSSQALGGHQNXXXXXXXXXXXXXXXXSDHLH 65
             K S EAN  D   SS R+FPCLFCSRKF+SSQALGGHQN                 D ++
Sbjct:    17 KPSKEANKTDENTSSLRIFPCLFCSRKFHSSQALGGHQNAHKKERTAARRAKRAY-DFVN 75

Query:    66 QYASTTPSLPPMVFAPSXXXXX-MGQQLMHPSSMYISAHSSNFGYFPTQQHFASASDRSK 124
                    +LP  + +PS      +G       + + + H  +  +  +  H   A+    
Sbjct:    76 NN-DFLHTLPVFLSSPSQHHLTILGYPASASVACFPTVHPDHPIFKSSGSHVVLATSHQG 134

Query:   125 SNGAAARFDHQNNTVNQIIGSVANADKGKDSKLDLSLHL 163
              +        Q   +     +V N+DKGKD  LDLSLHL
Sbjct:   135 RDCKGGYCCQQRVDILDHHYNVVNSDKGKDQCLDLSLHL 173




GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0042752 "regulation of circadian rhythm" evidence=IMP
GO:0048579 "negative regulation of long-day photoperiodism, flowering" evidence=IMP
TAIR|locus:2825107 ZFP7 "AT1G24625" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174547 ZFP2 "AT5G57520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159088 KNU "AT5G14010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025777 ZFP1 "AT1G80730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181007 AT5G01860 "AT5G01860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013820 ZFP4 "AT1G66140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183780 AT5G10970 "AT5G10970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146960 ZFP3 "AT5G25160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_II002395
hypothetical protein (190 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 163
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.46
KOG1074958 consensus Transcriptional repressor SALM [Transcri 97.82
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 97.82
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 97.79
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.66
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 97.43
KOG3576267 consensus Ovo and related transcription factors [T 97.38
PHA0061644 hypothetical protein 97.23
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.95
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 96.57
PHA0276855 hypothetical protein; Provisional 96.54
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.49
KOG3576267 consensus Ovo and related transcription factors [T 96.37
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.24
PHA0276855 hypothetical protein; Provisional 95.79
smart0035526 ZnF_C2H2 zinc finger. 95.57
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.02
PHA00733128 hypothetical protein 93.96
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.1
PHA00733128 hypothetical protein 92.15
PHA0073279 hypothetical protein 91.76
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.54
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 89.41
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 87.6
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.69
KOG3608467 consensus Zn finger proteins [General function pre 83.59
KOG3993500 consensus Transcription factor (contains Zn finger 82.93
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 80.87
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=98.46  E-value=7.7e-08  Score=82.66  Aligned_cols=52  Identities=17%  Similarity=0.347  Sum_probs=49.4

Q ss_pred             CCCCCCCcccccCCCCCCCCceeeCCCCCccccCchhhhhhhhhccCccchH
Q 035649            2 GDDHHRGKVSAEANVDDSSPRVFPCLFCSRKFYSSQALGGHQNAHKKERTAA   53 (163)
Q Consensus         2 g~~~~~~~~~~~h~~~HTg~KPfkC~~CgksFsssqsL~~HqriHtgERp~a   53 (163)
                      |+.|-+-=.|+-|-|+|||+|||.|..|+|.|..+.+|..||++|.+.|.|.
T Consensus       194 GKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~q  245 (279)
T KOG2462|consen  194 GKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQ  245 (279)
T ss_pred             cccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCcccc
Confidence            7888888899999999999999999999999999999999999999988876



>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 6e-16
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 66.3 bits (162), Expect = 6e-16
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 21 PRVFPCLFCSRKFYSSQALGGHQNAHKKERTAAR 54
          PR + C FC R+F S+QALGGH N H+++R   R
Sbjct: 4  PRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 37


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.87
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.86
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.77
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.76
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.74
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.74
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.73
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.73
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.73
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.72
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.72
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.71
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.71
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.71
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.71
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.71
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.7
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.7
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.7
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.7
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.69
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.69
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.69
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.68
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.68
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.68
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.68
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.67
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.66
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.66
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.65
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.64
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.62
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.61
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.61
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.61
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.57
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.49
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.47
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.46
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.46
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.45
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.4
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.39
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.38
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.36
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.32
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.31
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.31
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.28
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.27
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.25
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.24
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.24
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.22
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.22
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.22
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.2
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.19
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.19
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.18
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.17
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.13
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.11
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.1
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.1
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.09
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.04
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.04
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.04
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.03
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.03
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.03
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.01
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.0
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 97.99
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 97.99
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 97.98
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.98
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.97
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.97
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 97.97
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 97.97
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 97.96
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 97.96
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.96
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 97.96
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 97.95
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 97.94
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 97.94
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.17
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.17
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.91
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 97.91
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.9
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.9
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.9
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 97.89
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 97.89
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.86
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.85
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 97.84
2epa_A72 Krueppel-like factor 10; transforming growth facto 97.84
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.82
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 97.81
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 97.8
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 97.8
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 97.79
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 97.77
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 97.73
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 97.73
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 97.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 97.72
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 97.71
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 97.7
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 97.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.69
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 97.68
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 97.67
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.82
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 97.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 97.63
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 97.63
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 97.61
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 97.6
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 97.58
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 97.58
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.55
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.53
2epa_A72 Krueppel-like factor 10; transforming growth facto 97.52
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 97.48
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.48
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 97.4
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.38
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.36
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.35
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.28
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 97.23
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 97.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 97.12
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.05
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 97.03
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 96.79
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 96.71
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 96.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 96.33
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.02
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.97
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.93
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 95.92
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 95.91
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 95.82
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 95.75
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.75
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 95.69
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 95.68
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 95.67
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.65
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.65
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 95.64
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.62
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.58
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 95.55
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 95.55
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.51
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 95.5
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.47
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 95.44
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 95.43
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.39
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.38
1vd4_A62 Transcription initiation factor IIE, alpha subunit 95.37
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 95.35
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.31
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.31
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.29
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 95.26
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.24
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 95.18
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 95.18
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.13
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 95.12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 95.0
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.98
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.96
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 94.96
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.9
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 94.89
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.86
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.82
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.8
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.76
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 94.73
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 94.72
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 94.72
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.72
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.69
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.64
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 94.59
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 94.54
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 94.44
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 94.11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.33
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 93.21
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 93.16
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.96
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.96
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.88
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.79
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.74
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 92.57
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.4
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 92.25
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 92.16
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 92.14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 92.04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.87
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 91.72
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 91.7
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 91.69
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 91.47
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.4
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.27
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 91.16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.02
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 90.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 90.89
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 90.87
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.83
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 90.61
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.24
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 90.11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.92
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.85
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 89.84
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 89.81
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 89.58
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.41
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.15
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 89.02
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 88.84
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 88.61
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 87.35
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.3
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 85.63
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 85.45
2e72_A49 POGO transposable element with ZNF domain; zinc fi 83.73
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 82.42
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
Probab=98.87  E-value=6.9e-10  Score=69.54  Aligned_cols=51  Identities=12%  Similarity=0.166  Sum_probs=47.2

Q ss_pred             CCCCCCCcccccCCCCCCCCceeeCCCCCccccCchhhhhhhhhccCccch
Q 035649            2 GDDHHRGKVSAEANVDDSSPRVFPCLFCSRKFYSSQALGGHQNAHKKERTA   52 (163)
Q Consensus         2 g~~~~~~~~~~~h~~~HTg~KPfkC~~CgksFsssqsL~~HqriHtgERp~   52 (163)
                      ++.+.....|..|.++|+++++|.|.+|++.|.....|..|+++|+++++|
T Consensus         3 ~k~~~~~~~l~~h~~~H~~~k~~~C~~C~k~f~~~~~L~~H~~~H~~~kp~   53 (54)
T 1yui_A            3 AKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPG   53 (54)
T ss_dssp             CCCCSCSSCCCCCHHHHTSSCCEECTTTCCEESSHHHHHHHHHHHTTTSCC
T ss_pred             ccccCCCcchhhHHHhcCCCCCccCCCCCcccCCHHHHHHHHHHhccCCCC
Confidence            456777888999999999999999999999999999999999999999886



>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 163
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 1e-11
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 53.9 bits (130), Expect = 1e-11
 Identities = 18/34 (52%), Positives = 24/34 (70%)

Query: 21 PRVFPCLFCSRKFYSSQALGGHQNAHKKERTAAR 54
          PR + C FC R+F S+QALGGH N H+++R   R
Sbjct: 3  PRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 36


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.07
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.93
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.88
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.83
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.7
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.66
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.6
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.59
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.56
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.43
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.27
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.24
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.2
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 98.06
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.95
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.93
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.92
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 97.88
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.81
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.56
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.44
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.37
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.12
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.76
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.58
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.49
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.3
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.99
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.98
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 95.64
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.55
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.36
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.03
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 94.86
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.84
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.81
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.75
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.53
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.9
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.73
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.69
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 92.72
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.14
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 91.81
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 87.84
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 85.34
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 83.37
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 81.08
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.07  E-value=3.3e-11  Score=72.57  Aligned_cols=37  Identities=24%  Similarity=0.483  Sum_probs=35.8

Q ss_pred             cCCCCCCCCceeeCCCCCccccCchhhhhhhhhccCc
Q 035649           13 EANVDDSSPRVFPCLFCSRKFYSSQALGGHQNAHKKE   49 (163)
Q Consensus        13 ~h~~~HTg~KPfkC~~CgksFsssqsL~~HqriHtgE   49 (163)
                      .|+++|++++||+|.+|++.|.....|..|+++|++|
T Consensus         2 rH~~~Ht~ekpy~C~~CgK~F~~~s~L~~H~r~HtGE   38 (38)
T d2cota2           2 RSEWQQRERRRYKCDECGKSFSHSSDLSKHRRTHTGE   38 (38)
T ss_dssp             CCCSCCCCSCSSBCSSSCCBCSCHHHHHHHHTTTCCS
T ss_pred             ccCcccCCCCCEecCCCCceeeCHHHHHHhCccCCCC
Confidence            6899999999999999999999999999999999987



>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure