Citrus Sinensis ID: 035742


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
ADALLKWKASLQSHNRSLLPSWTNATTNVSSKICPCAWFGISCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLVLVLEVIKGKHPRDFLCSILSSSLTKDVALDEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI
ccHHHHHHHcccccccccccccccccccccccccccCEEEEEEcccccEEEEECcccccCEECccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcc
ADALLKWKASLQSHNRSLLPSWTNATTNVSSKICPCAWFGISCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLVLVLEVIKGKHPRDFLCSILSSSLTKDVALDEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTM***S*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ADALLKWKASLQSHNRSLLPSWTNATTNVSSKICPCAWFGISCSDAGRVINISLRNTGLSGTLSDFSFSSFPQLVHLDLSLNGFLGTIPSQIGNLSKLSYISLQSNQLSGKIPLEVGLLTHLKVLHFQFNQLKLLVLVLEVIKGKHPRDFLCSILSSSLTKDVALDEMLDPRLPTSSCSVQEKLISIMGVAFPCLNESPVSRPTMQTVSQQLQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 1-138
View the alignment between query and template
View the model in PyMOL
Template: 4ECN, chain A
Confidence level:very confident
Coverage over the Query: 1-152
View the alignment between query and template
View the model in PyMOL
Template: 2O6S, chain A
Confidence level:confident
Coverage over the Query: 46-179
View the alignment between query and template
View the model in PyMOL
Template: 3HMM, chain A
Confidence level:probable
Coverage over the Query: 167-213
View the alignment between query and template
View the model in PyMOL