Citrus Sinensis ID: 035762

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MDVKKAGSSLDSLISSFNTRIADLQELVIARNMYPVSTVADLSAIDAAVKAVELQVQAIKSRVREETEAIPKAKKLIDASLRQQKILQNMSSYASSSLSQTMSMLDLNTTKTLLPESSKQQSNSVSFKPEEPAALPKEKKGRGSPPLWYITSDELDSLSSYMRGRLTLEKVNAAVNDMATYAEANAHLISAPKKKLAGNLWERALELRDIATVEAVKGKHFFLENDVKGPSLKLDNTGKAILTVLRHLGRISETRIGHHRVIILLKPQ
cccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHcHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHccHHHHccccEEEEEEEccc
***********SLISSFNTRIADLQELVIARNMYPVSTVADLSAIDAAVKAVELQVQAIKSR***************DASLRQQKILQNMSSYAS***************************************************LWYITSDELDSLSSYMRGRLTLEKVNAAVNDMATYAEANAHLISAPKKKLAGNLWERALELRDIATVEAVKGKHFFLENDVKGPSLKLDNTGKAILTVLRHLGRISETRIGHHRVIILLKP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVKKAGSSLDSLISSFNTRIADLQELVIARNMYPVSTVADLSAIDAAVKAVELQVQAIKSRVREETEAIPKAKKLIDASLRQQKILQNMSSYASSSLSQTMSMLDLNTTKTLLPESSKQQSNSVSFKPEEPAALPKEKKGRGSPPLWYITSDELDSLSSYMRGRLTLEKVNAAVNDMATYAEANAHLISAPKKKLAGNLWERALELRDIATVEAVKGKHFFLENDVKGPSLKLDNTGKAILTVLRHLGRISETRIGHHRVIILLKPQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Spindle and kinetochore-associated protein 1 homolog confidentQ9LZZ7
Spindle and kinetochore-associated protein 1 homolog probableQ7XAM0
Spindle and kinetochore-associated protein 1 homolog probableB8B624

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LYC, chain A
Confidence level:very confident
Coverage over the Query: 143-264
View the alignment between query and template
View the model in PyMOL
Template: 4AJ5, chain A
Confidence level:confident
Coverage over the Query: 7-84
View the alignment between query and template
View the model in PyMOL