Citrus Sinensis ID: 035832


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----
VNLRKKRAGGISCDYSCLEVRDVSYRPPGTQVDILNGVSFSLPEKSFGLIFGRSGSGKTTLLQLLAGLSKPTSGSINIRGYNNDGEPNNSPEPLPPEKVGIVFQFPERYFVADNVLDEVIFGWPRQSGSIQLKEYLALNLQRAINWVGLDGTSLDKDPHSLSGGYKRRLALAIQLVQVPDLLILDEPLAGLDWKARADVVKLLKHLKKELTILVVSHDLKEMAALVDHSWRMDMGGFLVEQRIPV
cccccccccccccccccEEEEEEEEEcccccccccccEEEEECcccEEEEEccccccHHHHHHHHcccccccCEEEEEccCCcccccccccccccccEEEEEccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEECccCEEEEccccc
*************DYSCLEVRDVSYRPPGTQVDILNGVSFSLPEKSFGLIFGRSGSGKTTLLQLLAGLSKPTSGSINIRGYNNDGEPNNSPEPLPPEKVGIVFQFPERYFVADNVLDEVIFGWPRQSGSIQLKEYLALNLQRAINWVGLDGTSLDKDPHSLSGGYKRRLALAIQLVQVPDLLILDEPLAGLDWKARADVVKLLKHLKKELTILVVSHDLKEMAALVDHSWRMDMGGFLVEQRIP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VNLRKKRAGGISCDYSCLEVRDVSYRPPGTQVDILNGVSFSLPEKSFGLIFGRSGSGKTTLLQLLAGLSKPTSGSINIRGYNNDGEPNNSPEPLPPEKVGIVFQFPERYFVADNVLDEVIFGWPRQSGSIQLKEYLALNLQRAINWVGLDGTSLDKDPHSLSGGYKRRLALAIQLVQVPDLLILDEPLAGLDWKARADVVKLLKHLKKELTILVVSHDLKEMAALVDHSWRMDMGGFLVEQRIPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter I family member 11, chloroplastic confidentQ8LEF6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BK7, chain A
Confidence level:very confident
Coverage over the Query: 13-125,137-235
View the alignment between query and template
View the model in PyMOL
Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 14-81,97-240
View the alignment between query and template
View the model in PyMOL